KEGG   Leishmania major: LMJF_36_6550Help
Entry
LMJF_36_6550      CDS       T01014                                 

Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LMJF_36_6550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:complement(2536597..2537376)
Genome map
AA seq 259 aa AA seqDB search
MAWHCSSTTNAGMVTALQREGLIKTPEVMEVMRRVDRGWFVRNSKDAYRDQPLPIGFGVT
ISAPHMHAIMLELVSPSVLRHKNLDRGHCQPLRLLDIGSGSGFMTAAFAALCEAAWRDGE
PPMFEVVGIEHVQELQKQSKRVLESHFPEWIRERRVTLLHGDGRKPRSIAGVGEEKGECF
DVIHVGATAPKTLVPEYLSLLRCGGTLVIPVGNPAEVQELQVFTKGDEGAFTMRRACHVQ
FVPLTSLHAQLDGDATTRT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcactgctcgtcgacgacgaatgcggggatggtgactgcactgcagcgcgag
ggtctcatcaaaacacccgaggtgatggaggtgatgcggcgtgtggaccgcggctggttc
gtgcgcaactccaaggatgcttaccgtgaccagcctctgcccatcggattcggcgtgacc
atcagcgctccacacatgcatgctatcatgttggagctggtgagtccgtctgtgctgcgc
cacaagaatctggaccgaggtcattgccaaccgctgcgactgctggacatcggtagtggc
agcggcttcatgacggctgcctttgccgcgctgtgtgaggcggcttggcgagacggtgag
ccgcctatgtttgaggtggtgggtatcgagcacgtgcaggagcttcagaagcagtcaaag
cgtgtcctcgagtcgcacttccctgagtggattcgcgagcgccgcgtcacattgctgcat
ggagacggacgaaagcctcgctccatcgcgggtgtcggtgaggaaaaaggtgaatgcttt
gacgtcatccacgtcggcgccaccgcgccgaagactctcgtgcccgagtacctaagcctt
ctccggtgcggtggtacgctggtgatccccgttggtaacccggccgaggtgcaggagtta
caggtgttcacgaagggcgatgaaggcgctttcacgatgcgacgggcgtgccacgtgcag
tttgtgccgctcacatctctacatgcccagctcgatggcgacgcgacgacgcgcacgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system