KEGG   Leishmania major: LMJF_36_6940Help
Entry
LMJF_36_6940      CDS       T01014                                 

Gene name
PDI-2
Definition
protein disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
lma  Leishmania major
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:complement(2662351..2663784)
Genome map
AA seq 477 aa AA seqDB search
MQRSFLVFVLCALLFCVASAEVQVATKDNFDKVVSGDLTLVKFYAPWCGHCKTLAPEFVK
AADMLAGIATLAEVDCTKEESLAEKYEIKGFPTLYIFRNGEKVKIYDGPRTAAGIASYMK
AHVGPSMKAISTAEELEELKKETFPVCVVKTASTDSEMASMITKVADSLRSQMNFVLVTD
AAISPNDAMESVTVYRKNAEREAYTGATPMTAESVKSFLTSAVLDYFGELGQESFQKYME
ANKDKPLGWVFIDKNTDSALKGSLVAVAEKYRSQVLLTYIDGDQYRPVSRQLGIPEDAKF
PAFVVDFERRHHVMGTDTPVTSESVAAFVEKYVKGETKQTVMSDAIPAKETVNGLTTVVG
QTFAKYTDGTQNVMLLFYAPWCGHCKKLHPVYDKVAKSFESENVIIAKMDATTNDFDREK
FEVSGFPTIYFIPAGKPPIVYEGGRTADEIQVFVKSHLTASAAPSGGPSGNSEEEDL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgctcattccttgtttttgttctgtgcgcccttctcttctgcgtcgcgtccgca
gaggtgcaggtggccactaaggacaactttgacaaggtcgtaagcggggatctcacgttg
gtcaagttttatgctccgtggtgcggccactgcaagacactcgccccggagtttgtaaag
gccgctgacatgctggccggcatcgcgacccttgcagaggtcgattgcaccaaagaagag
agccttgctgagaagtacgaaatcaaggggttccccacgctgtacatcttccgtaacggt
gagaaagtgaagatctacgatggtccccgcactgccgccggcatcgcgtcgtacatgaag
gcgcatgtcggtccatcgatgaaggccatctcaacggctgaagagctggaggagctcaag
aaggagactttcccggtgtgcgtggtgaagacagcgagcaccgactcggagatggcgtcg
atgataaccaaggtggcggactctctccgctcgcagatgaactttgtgctcgtgacggat
gcggccatctctccgaatgatgccatggagtcggttacggtgtatcgcaagaatgcggag
cgcgaggcgtacaccggcgctacaccaatgacggcagagtcggtgaagagctttctcacg
agtgctgtgttggactactttggcgagctcggccaggagagctttcagaagtacatggaa
gcgaacaaggataaacctcttgggtgggtgttcatcgacaagaacacggattctgcgttg
aaggggtcacttgtggcggtggcggagaagtaccgctcgcaggtgttgctaacctacatt
gacggcgatcagtaccgccccgtctcgcgccagctgggcattcctgaggatgcgaagttc
ccggcgtttgtggtcgatttcgagcgccgccatcacgtgatggggacggacaccccagtc
acctccgagtctgtcgctgcgtttgtggagaagtatgtcaagggcgagacgaagcagacc
gtgatgtccgacgcgattcccgctaaggagacggtgaacggcctcacaacggtggtgggt
cagacttttgcgaagtacacggacggcacacaaaacgtgatgctgctcttctacgcgccg
tggtgcggacactgcaagaagctgcaccccgtctacgataaagtggccaagagcttcgag
tctgagaatgtgatcattgcgaagatggatgccacgacgaacgactttgaccgcgagaag
tttgaggtgtctggatttccaacgatttacttcatcccagccggcaagccgccaatcgtg
tacgagggtggccgcaccgcagacgaaatccaggtgtttgtgaagtctcacctgaccgcc
tccgccgctccatctggcggcccttccggcaacagcgaagaggaagatttgtag

DBGET integrated database retrieval system