KEGG   Listeria monocytogenes CLIP 80459: Lm4b_00187Help
Entry
Lm4b_00187        CDS       T00898                                 

Definition
(GenBank) Putative YabH protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmc  Listeria monocytogenes CLIP 80459
Pathway
lmc00900  Terpenoid backbone biosynthesis
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01130  Biosynthesis of antibiotics
Module
lmc_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Lm4b_00187
Enzymes [BR:lmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Lm4b_00187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAS03978
UniProt: C1KYC3
Position
190677..191558
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggacggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaagcacactttatt
ccagaagatcgtcgcaatttaatttatcaagcagccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcacattcctgtttctgcgggtcttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcggaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactgggcgcggggaaaagatttctgcgttacctaat
attcctggttgttggattgtgcttgctaaaccgagcattagcgtgtctaccccgactatc
tataaagaacttcaagtagataacgtagaacacccagacacacaaaaaatgattgaatcc
attaaaaatggcgatttagacgggatatttgcgtctacaggaaatgtattagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggccctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaataattaa

DBGET integrated database retrieval system