KEGG   Listeria monocytogenes Clip81459: Lm4b_00222Help
Entry
Lm4b_00222        CDS       T00898                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229271..230086
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPG
FSEVTPEEELNRIIPVIKAVRTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEP
KIAEVAAKYNVPICLMHNRENTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacttaggtatggtcatggggatactgaatgttacgcca
gactctttttcggatggcgggaaatatatgcaagtggaagaagctgtggctcgagcgtta
caaatggcagaagatggagcagcaattattgacgttggtggaatatctactcggcctggt
ttttcagaggtaacgcctgaggaagaacttaatcgaattattcctgtcattaaagctgtt
aggacaaaacttccggatatatggatttctgttgatacttggcgtgccgaagtggctgaa
aaagctattttagcaggagctaatatgataaatgatcaatggggtgccaaaaaagaaccg
aaaattgctgaagtagctgcgaaatataacgtgccaatttgtttgatgcacaaccgagaa
aacacgcaatacgataattttctggaagatgtgaagaaagacttattagaaagtgttgca
attgctaaagcggcatccgtgccagatgaacatattattcttgatccgggtttcggtttt
gttaagacgcctgcgcagaatttagaagtgttacgacgcattgatgagatagtggcgctt
ggttacgaggttttacttggtacgagtagaaagtcgacaattggtctcgtcttaggaact
actccagaggatagaatggaaggaactggggcgacaaccgtttacggattttcgaaaggt
tgcacaattactcgtgtacacgatgtacttccaattgcgcgcatggtaagaatgacagac
gcgattacgggcaaattagatattacaaaattataa

DBGET integrated database retrieval system