KEGG   Listeria monocytogenes Clip81459: Lm4b_00224Help
Entry
Lm4b_00224        CDS       T00898                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230467..230946
Genome map
AA seq 159 aa AA seqDB search
MAKVFLSIGTNLGERLENLNDALSGLAASDKIKITNVSSVYETDAVGYEDQAAFLNIAVE
IETDFPPVDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDVKIDTEKLKIPHPYMKE
RAFVLIPLIEISPEKSNLVDNPAILEEQGVRKIKNQVNW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggtgtttctatcaattggtacaaaccttggcgaacgtttagaaaatttaaat
gacgcactaagtggtttagctgcttcagataaaattaaaattaccaacgtatctagtgta
tacgaaacagacgcagtaggttacgaagatcaagcggcatttttaaatatcgctgtagaa
attgaaacggactttccgccagttgatttactagatttttgtcttgcgctcgaacttgaa
ttggggcgagttcgattatttaagtggggtccgcgactcattgatatcgatgttttatta
tatgatgatgttaaaatcgatacagaaaagctgaaaatcccacatccttatatgaaagaa
cgcgcttttgtgctgattccattaatagagatttcaccagaaaaaagcaatcttgtagat
aatccagccattttggaagaacaaggtgttcggaaaataaaaaatcaagtcaactggtaa

DBGET integrated database retrieval system