KEGG   Listeria monocytogenes Clip81459: Lm4b_00278Help
Entry
Lm4b_00278        CDS       T00898                                 

Definition
exo-alpha-1,4-glucosidase
Orthology
K01182  
oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lmc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
270957..272654
Genome map
AA seq 565 aa AA seqDB search
MEITETKEWWKESVVYQIYPRSFQDSNGDGIGDIRGIIERLPYLKDLGINVIWLCPVYKS
PMDDGGYDISDYYEIDPMFGTMSDMDELIEKAEKLGIKILMDLVVNHTSDEHEWFEKAIA
DPKSKYRDYYIFREGVNGNPPNNWRSYFGGSAWEAVPGEENMFYLHAFSKKQPDLNWENI
VVRNECIQMINWWLEKGLGGFRIDAILNLKKRIEYGTFPADGEDGLVFIGHWILNQPGIE
EWLKEIDERTFKKHNAFTVAEADVPEERLSEFIGENGHFRMVFDFSYTDIDTPETGEWFK
NSEWTVKELKEKIITNELVTQRNGWGAKYLENHDQPRSINKYLPQEYQDDRSKKMLGTLF
MMLHGTPFIYQGQEIGMSNTRMESIDDYNDIATHDQYHRAILSGMSPEEALEGMYRRSRD
NSRTPMQWNNQKNAGFSDSDEIWLKANPNYLDINVEQEQIDDNSVLNFYKKLIHLRSDSS
KYKEVAVYGELLPVESSDEVIAYKRKTDDAELLIIVNFSDSENQLCIEGTYEQVLANVAL
PEMVENVLEIPAYTGAVFSRVLEVD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtggaaataacagaaacgaaagaatggtggaaagaatcggtagtgtaccaaatctatccg
cgtagttttcaagattcaaatggggatggtattggagatattagaggaattatagaacga
cttccttatttgaaagatttaggtattaatgtgatttggctttgtcctgtctataaatca
cctatggatgatggtggttatgacatttctgattactatgagattgatccaatgtttgga
acgatgagtgatatggatgaattaattgagaaggcagaaaaattaggaataaaaatattg
atggatttggtggtaaaccatacatctgatgaacatgaatggtttgaaaaagcaatagct
gacccaaaaagtaaatatcgagattattatattttccgagagggtgtaaatggaaacccg
cctaataattggcgttcttattttggaggatctgcgtgggaagccgtaccaggtgaggaa
aacatgttttacctacatgctttttctaaaaaacagccagatttaaactgggaaaacatt
gtagtgcgtaatgaatgtatccaaatgattaactggtggcttgaaaaaggtttaggtggc
tttagaattgatgccattttaaatttgaagaaaagaattgagtacggtactttcccagcg
gacggggaagatggcttggttttcatcggtcattggattttaaatcagccgggaattgaa
gagtggctcaaggagattgacgaacggacatttaaaaaacataatgcatttactgtggct
gaggcggatgtgcctgaagaaagactttctgaatttataggtgaaaatggtcatttccgt
atggtgtttgattttagctatacagatattgatactcctgaaacaggcgaatggttcaag
aattcagaatggacagtaaaagaattaaaagagaaaataattaccaatgaactggtgaca
cagcgaaatggttggggggcaaaatacttagaaaatcatgatcaaccgcgttcgataaat
aagtatttacctcaagaataccaagatgatcgtagcaaaaaaatgctaggcacgttattt
atgatgttgcacggtacgccgttcatttatcaaggacaagagattggtatgagtaatact
cggatggaaagtatagatgattataacgatattgcgacgcacgatcaataccatcgcgca
attctctctggaatgagtccggaagaagcgcttgaaggaatgtatcggcgtagtagggat
aattcaagaacaccgatgcaatggaataatcaaaagaacgctggtttttccgactcagat
gaaatttggttgaaagcaaaccctaattaccttgatattaacgtagagcaggaacaaatc
gatgataattccgtattgaatttttataagaaattaatccatttaagaagtgattctagt
aaatataaagaagtggctgtttatggagaattactgccagtagaatcaagtgatgaagtt
attgcttacaaacgtaaaacagatgacgctgagctcttaatcatcgtgaatttttctgat
tctgaaaatcaattatgcattgaaggtacttatgaacaggtacttgctaatgtagcgttg
ccagaaatggtagaaaatgtccttgaaatacctgcatatacaggtgccgtcttctcaagg
gttttggaggtagactga

DBGET integrated database retrieval system