KEGG   Listeria monocytogenes Clip81459: Lm4b_00299Help
Entry
Lm4b_00299        CDS       T00898                                 

Definition
phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lm4b_00299
Enzymes [BR:lmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Lm4b_00299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(301693..303129)
Genome map
AA seq 478 aa AA seqDB search
MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIPGTTFKGTNGDVAVDH
YHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFYDNLIDELLKYDIEPLV
TLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNEQNIFVGMGYG
QALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIGPSFAYTPHYPIDTDPKNV
QAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIEDGDMELLASAKPDFMGVNY
YQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKKVVNPFVKTTNWDWTIDPKGL
QIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRIDYLSAHATAIRDAISDGVDML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTRIPKKSYYWYKQVIETNGADL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcaaaaacgttcaccattcccgaaagatttcttatggggttctgcatcggca
gcttatcaaatcgaaggcgcatgggacgcagacggcaaaggtaaatcagtttgggacgaa
tatgtccgcattcctggaactacttttaaaggtacaaatggcgatgtagctgtcgaccat
tatcaccgttataaagaagacgtaaaactaatggcagacgctggcctaaaagcttaccgt
ttctctatcgcttggactcgtatttttccaaatggtaaaggcgaagtgaatgaagctgga
ttgaaattttatgataacttgattgatgagttgcttaaatatgacattgaaccgcttgta
acgctttatcactgggatatcccacaagcattatttgatgaatacggtggctgggaatct
cgccaagttattgaagatttcacaaattattccacaacgctattcaaacgttacggcgac
cgcgtgaaatattgggtttccttgaatgagcaaaatatctttgttggtatgggttatggt
caagcgcttcacccgccaaaagttagcgatccaaaaagaatgtacgcagtaaaccatatt
gcgaacttagctaatgcgagtgttatcaaagctttccacgaaatcgttcctgatggaaaa
attggaccaagttttgcttacacaccacattatccaatcgacacagatcctaaaaacgtt
caagctgccgacgatgcagaagaattaaacagttatttctggatggatatgtatgctttt
gggcgctatccgaaagcggtttggaaatatttagaagaaaacgatattgcgccagttatt
gaagacggcgatatggaacttcttgcttctgcaaaaccagatttcatgggcgtaaactat
taccaatccgcaactgttgcttacaacccgcttgatggcgttggtcaaaacaacgaaatg
aacttcactggtaaaaaaggtagcacgaaagagactggtgttcctggcgtttacaaaaaa
gtcgttaatccttttgtgaaaacaacgaactgggactggacaatcgatccaaaaggctta
caaattgcgcttcgtcgtattaacagccgctatgctttaccaattttaattacagaaaac
ggtttaggtgaatttgataaattagttgatggtgaagtaaacgatgactaccgtattgac
tatctaagcgcgcacgcaactgctattcgcgatgcaatcagtgatggcgttgatatgtta
ggctattgtacttggagcttcacagaccttctaagctggttaaacggctatcaaaaacgt
tacggttttgtttatgttgaccgcgatgtggaagatgatgcgccaatgacacgtattccg
aagaaaagttattattggtataaacaagtgattgaaactaatggagcagatttataa

DBGET integrated database retrieval system