KEGG   Listeria monocytogenes Clip81459: Lm4b_00338Help
Entry
Lm4b_00338        CDS       T00898                                 

Definition
phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(341476..342891)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPANFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccagccaactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggatttggtcacattactgacggtccaacaccagataacttaaaattagaagga
attgacttctatcatcgctacaaagatgatgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggattacaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctcactttcaatgaaatcaactccattttacac
gcaccattcatgagcggcggtatttctacaagcccagataaattatctcaaaaagactta
tatcaagctgtccaccacgaacttgtggcgagcgcgctggctacaaaaattggtcacgaa
atcatgcccgaagcccaaatcggctgcatggtcctagcaatgccaacttatccgctaact
tccaacccagatgatattattgctgttatggaagcagagcgcaaaaactacttcttctcc
gacgttcatgtccgcggaacttatccgggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tccttcagctattacatgagcacaaccgaaacagctgacgagtcaaaacgcaaagctggc
gcaggaaacatcctaggcggcgtgcaaaacccttacctagaagcatccgaatggggctgg
caaatcgatcctcaaggcttgcgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgatgactaccgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttgtaagtgcctccactgctgaaatgaaaaaacgttacggctttatctatgtcgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aagaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system