KEGG   Listeria monocytogenes Clip81459: Lm4b_00364Help
Entry
Lm4b_00364        CDS       T00898                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lm4b_00364
   01230 Biosynthesis of amino acids
    Lm4b_00364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lm4b_00364
   00051 Fructose and mannose metabolism
    Lm4b_00364
   00562 Inositol phosphate metabolism
    Lm4b_00364
Enzymes [BR:lmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lm4b_00364
Exosome [BR:lmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lm4b_00364
  Exosomal proteins of bladder cancer cells
   Lm4b_00364
  Exosomal proteins of melanoma cells
   Lm4b_00364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(375146..375910)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSMGTLETTANLLAGTLF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttaaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacattattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgacttaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcgaagaagattaaacttgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccgtgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaagcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggagtgggcaattggaaaggcgtcttcagctgag
acaaactacatcgaaagcgcgcatcaagcgctgcgtgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system