KEGG   Listeria monocytogenes Clip81459: Lm4b_00593Help
Entry
Lm4b_00593        CDS       T00898                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lmc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(607767..609050)
Genome map
AA seq 427 aa AA seqDB search
MKILTGTVNELLNELKIETDTNTSIQVETEVKTIIEKVKTAGDQALFDFTSKFDGVGLTE
LRVPAADIQAASAKIEPAFLDALQQAKVNIESFHSKQKQHAFLDSEKDGVIRGQLIRPLE
TVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPGENGINPYVLASAQLAGVDEIY
QVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADE
NANPAFIAADLLSQAEHDILARAILITTSKKIAEETQNEIDKQLENLPRKAIAQKSIETR
GKIIIAATTQEMFDIMNEIAPEHLEVQLENPMNYLYQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKDAIVLLAKKEGLDAHAKAIQ
IRFEEEN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaaccggaacagtaaatgagctattaaacgagctcaaaatagaaactgat
acgaacacttccatccaggtggaaaccgaagtaaaaacgattatcgaaaaagtcaaaaca
gctggcgaccaagccctatttgacttcacatccaagtttgacggcgtagggctcaccgaa
ctccgcgttccagccgctgacatccaagctgcaagcgcaaaaatcgaacctgccttctta
gacgcgctccaacaagcaaaagtaaatatcgaaagtttccacagcaagcaaaaacaacat
gctttccttgatagtgaaaaagacggcgtcattcgagggcaattaattcgtccactagaa
accgtcggcgtttacgttcccggtggcacagcagcctatccttcatcggttttaatgaat
gtgttgccagccaaaattgccggagtaaagcgaatcgtaatgattacccctcccggtgaa
aacggtattaatccttacgttctagcctcagctcaactagctggtgtggacgaaatttac
caagttggcggtgcacacggaatcgccgctctagctcacggaacagaatctatccctaaa
gtagataaaatcgtcggtcctggaaatatctatgtcgccactgccaaacgtgaagtattc
ggcttagttgatattgacatgatagccggtccatccgaaatcgtcgtgctcgcagatgaa
aacgccaatcctgcttttatcgcagccgacttactctcccaagcagagcacgatatttta
gcccgtgctatcttaatcacaactagtaaaaaaatcgccgaggaaacacaaaatgaaatt
gacaaacagctagaaaatctaccgcgaaaagcgattgctcagaaatctatcgaaacacga
ggaaaaatcattatcgcagcaaccacacaagaaatgttcgatatcatgaacgaaatcgcc
ccagaacacttagaagtacaacttgaaaatccgatgaactatctctatcaaattaaaaac
gctggctccattttcttagggagttatgcatcggaacctcttggcgactattttgctggc
ccaaatcacgtcttacctacaagtggtaccgcaaaattcttctctcctcttggtgttgaa
gattttaccaaacgttccgcctttatttcttatacaaaagaagcactcgcaaaggaaaaa
gatgctatcgttttacttgctaaaaaagaaggtctagacgcccatgccaaagccattcaa
attcgttttgaggaggaaaactaa

DBGET integrated database retrieval system