KEGG   Listeria monocytogenes Clip81459: Lm4b_00754Help
Entry
Lm4b_00754        CDS       T00898                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lmc00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lmc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
765217..767022
Genome map
AA seq 601 aa AA seqDB search
MCGIVGYIGTNNAKGILLEGLEKLEYRGYDSAGIALQNKDLVTVVKEKGRIADLASLVPS
DAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTMVHNGVIENYTLLKEEYLKNHSFVS
DTDTEVIVQLIELFAAELSTKEAFKKALSLLHGSYAICLIDQTDTETLYAAKNKSPLLIG
KGENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKDGFTLETLEGEEISRASYTAELDAS
DIEKGTYPHYMLKEIDEQPAVTRKIIQAYQNEAGEINVDQTILDEILSSDRIHIVACGTS
YHAGLVGKNLIEKMAKIPVEVHVSSEFGYNLPLMSKKPLFIFITQSGETADSRQCLVKVK
ELGYRTLTLTNVPGSTLDREADHSMYLYAGPEIAVASTKAYTAQISVLAVLAVSLGREIG
DAEALSINLAAELGIVATAMEAMVSSKEVIEHIAGEYLATSRNAFFLGRNIDYFVAMEAA
LKLKEISYIQAEGFASGELKHGTIALIEDGTPVLALITQESINWNIRGNVNEVLARGAKT
CVFAMENVAQPGDRFVIPQVHPLLTPLASVIPCQLLAYYAALHRDCDVDKPRNLAKSVTV
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgttggatatattggaacaaataatgcaaaaggcattttattagaagga
cttgaaaaattagaataccgcggctatgactctgcgggaatcgctttgcaaaacaaagac
ctagtaacagtagttaaagaaaaaggacggattgcagaccttgcgagccttgtaccaagt
gatgcattcggtacaacaggaatcggacatacacgctgggcaacgcacggtaaaccaaat
cacgaaaacgcccacccgcaccaaagcaaatctggtcgttttacaatggttcataacggc
gtaatcgaaaactatacccttttaaaagaagaatacttaaaaaatcattcatttgttagt
gatacggatacagaagtaatcgttcagcttattgaactctttgcagcagaactttcgact
aaagaagcattcaaaaaagcgttatcgttacttcatggttcttacgcgatctgcttaatt
gaccaaaccgatacagaaacactatacgcagcaaaaaacaaaagcccattactaatcgga
aaaggcgaaaacttcaacgttattgcaagtgatgcaatggctgttcttaaagaaacagat
gaattcgtggaaattatggataaagaaatcgttatcgttacaaaagacggttttacatta
gaaacattagaaggggaagaaattagccgcgcgagctacactgctgaattagatgcatct
gacatcgaaaaaggcacatacccgcactatatgttaaaagaaatcgacgaacaaccagca
gtaacacgtaaaatcatccaagcttaccaaaacgaagctggggaaatcaatgtcgatcaa
acaatccttgatgaaattttatcttctgaccgtattcatattgtcgcttgtggtacgagc
tatcatgctggtttagtcggaaaaaatttaatcgaaaaaatggcgaaaattcctgtagaa
gtacatgtttctagtgaatttggttataatttaccgctaatgtctaaaaagccgttattc
attttcattacccaaagtggggaaacagctgatagccgccaatgccttgtaaaagtgaaa
gaacttggttaccggacgctgacattaacgaacgtaccaggctctacgcttgaccgtgaa
gcggatcattcgatgtatctctatgctggacctgaaattgcggttgcatcaacaaaagca
tataccgcacagatttcggttttagcagtacttgcagtttcacttggtcgcgaaattggt
gatgctgaagcgcttagcattaatttagctgctgaattaggtatcgttgcaactgcaatg
gaagcaatggtttctagtaaagaagttatcgaacatattgcgggcgaatacttagcgact
tctcgtaacgccttcttcttaggtagaaacatcgattatttcgtagcgatggaagcagca
cttaaactaaaagaaatttcatatattcaagcagaaggttttgcaagtggggaattaaaa
catggtactattgcgcttattgaagatggcacaccagttttagcacttatcacgcaagaa
tctatcaactggaatattcgcggaaatgtaaatgaagtcttagcgcgtggagcaaaaact
tgtgtatttgcaatggaaaacgttgcgcaaccaggtgaccgctttgttattccgcaagtg
catccattattaacaccactagcgagcgttatcccgtgtcaattattagcttattacgca
gcacttcaccgtgactgtgatgtcgataaaccaagaaacttagcaaaaagtgtcacagta
gaataa

DBGET integrated database retrieval system