KEGG   Listeria monocytogenes Clip81459: Lm4b_00754Help
Entry
Lm4b_00754        CDS       T00898                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lm4b_00754
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lm4b_00754
Enzymes [BR:lmc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Lm4b_00754
Peptidases [BR:lmc01002]
 Cysteine Peptidases
  Family C44
   Lm4b_00754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
765217..767022
Genome map
AA seq 601 aa AA seqDB search
MCGIVGYIGTNNAKGILLEGLEKLEYRGYDSAGIALQNKDLVTVVKEKGRIADLASLVPS
DAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTMVHNGVIENYTLLKEEYLKNHSFVS
DTDTEVIVQLIELFAAELSTKEAFKKALSLLHGSYAICLIDQTDTETLYAAKNKSPLLIG
KGENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKDGFTLETLEGEEISRASYTAELDAS
DIEKGTYPHYMLKEIDEQPAVTRKIIQAYQNEAGEINVDQTILDEILSSDRIHIVACGTS
YHAGLVGKNLIEKMAKIPVEVHVSSEFGYNLPLMSKKPLFIFITQSGETADSRQCLVKVK
ELGYRTLTLTNVPGSTLDREADHSMYLYAGPEIAVASTKAYTAQISVLAVLAVSLGREIG
DAEALSINLAAELGIVATAMEAMVSSKEVIEHIAGEYLATSRNAFFLGRNIDYFVAMEAA
LKLKEISYIQAEGFASGELKHGTIALIEDGTPVLALITQESINWNIRGNVNEVLARGAKT
CVFAMENVAQPGDRFVIPQVHPLLTPLASVIPCQLLAYYAALHRDCDVDKPRNLAKSVTV
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgttggatatattggaacaaataatgcaaaaggcattttattagaagga
cttgaaaaattagaataccgcggctatgactctgcgggaatcgctttgcaaaacaaagac
ctagtaacagtagttaaagaaaaaggacggattgcagaccttgcgagccttgtaccaagt
gatgcattcggtacaacaggaatcggacatacacgctgggcaacgcacggtaaaccaaat
cacgaaaacgcccacccgcaccaaagcaaatctggtcgttttacaatggttcataacggc
gtaatcgaaaactatacccttttaaaagaagaatacttaaaaaatcattcatttgttagt
gatacggatacagaagtaatcgttcagcttattgaactctttgcagcagaactttcgact
aaagaagcattcaaaaaagcgttatcgttacttcatggttcttacgcgatctgcttaatt
gaccaaaccgatacagaaacactatacgcagcaaaaaacaaaagcccattactaatcgga
aaaggcgaaaacttcaacgttattgcaagtgatgcaatggctgttcttaaagaaacagat
gaattcgtggaaattatggataaagaaatcgttatcgttacaaaagacggttttacatta
gaaacattagaaggggaagaaattagccgcgcgagctacactgctgaattagatgcatct
gacatcgaaaaaggcacatacccgcactatatgttaaaagaaatcgacgaacaaccagca
gtaacacgtaaaatcatccaagcttaccaaaacgaagctggggaaatcaatgtcgatcaa
acaatccttgatgaaattttatcttctgaccgtattcatattgtcgcttgtggtacgagc
tatcatgctggtttagtcggaaaaaatttaatcgaaaaaatggcgaaaattcctgtagaa
gtacatgtttctagtgaatttggttataatttaccgctaatgtctaaaaagccgttattc
attttcattacccaaagtggggaaacagctgatagccgccaatgccttgtaaaagtgaaa
gaacttggttaccggacgctgacattaacgaacgtaccaggctctacgcttgaccgtgaa
gcggatcattcgatgtatctctatgctggacctgaaattgcggttgcatcaacaaaagca
tataccgcacagatttcggttttagcagtacttgcagtttcacttggtcgcgaaattggt
gatgctgaagcgcttagcattaatttagctgctgaattaggtatcgttgcaactgcaatg
gaagcaatggtttctagtaaagaagttatcgaacatattgcgggcgaatacttagcgact
tctcgtaacgccttcttcttaggtagaaacatcgattatttcgtagcgatggaagcagca
cttaaactaaaagaaatttcatatattcaagcagaaggttttgcaagtggggaattaaaa
catggtactattgcgcttattgaagatggcacaccagttttagcacttatcacgcaagaa
tctatcaactggaatattcgcggaaatgtaaatgaagtcttagcgcgtggagcaaaaact
tgtgtatttgcaatggaaaacgttgcgcaaccaggtgaccgctttgttattccgcaagtg
catccattattaacaccactagcgagcgttatcccgtgtcaattattagcttattacgca
gcacttcaccgtgactgtgatgtcgataaaccaagaaacttagcaaaaagtgtcacagta
gaataa

DBGET integrated database retrieval system