KEGG   Listeria monocytogenes Clip81459: Lm4b_00902Help
Entry
Lm4b_00902        CDS       T00898                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lm4b_00902
Enzymes [BR:lmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Lm4b_00902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
923517..924896
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDKKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQEQDQALGEFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQAVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATNITKKNSSYEISFVDGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPENKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEMMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggcttgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacaaaaaactaggcggg
aaatttgaaacggttaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggtgtaggcttagtgaaggatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcctacatttaccaccaaaaagcacttcatccgattccagaa
ggctcagtgatgggaattccaacagataaagaagcattgctagctagtacactcgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacaa
gatcaagcacttggcgaattctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggagatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaagcagttaaaaaatatgggaatttgatggatggcttaaaa
gaaagtagcatgcaaacgacagggacaaaagctactattggtgcttttcgaacattagaa
ggcgggctagatgcgttaccaaaagccattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacgaacattacgaaaaagaatagctcttacgaaatttcttttgta
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgctaatt
catttattagcagaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagatggaacaggctat
ctagttgccagaaccgctccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccagaaaataaaatgttactacgaggctttgttgggaaagcgggagaa
acttggttagagcaagcaagtgatgaagcaatcgtttcagctgttttgagagattatgcg
gaaatgatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgca
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
gcagattacccaggggtttattttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggagctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system