KEGG   Listeria monocytogenes Clip81459: Lm4b_01205Help
Entry
Lm4b_01205        CDS       T00898                                 

Definition
uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lm4b_01205
Enzymes [BR:lmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Lm4b_01205
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Lm4b_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205981..1207462
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPITQEEIEQILVKEAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLENGRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVVDVVPTKTKEELSEVS
ELLFTSKEAVERFFDYLAQLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQKNVSNLIIGSIVDTAEVTAILAEVEAMEMMPLYDMRPVTERPFDLASFEQ
VCFSSSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINNFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtcatgttaattggtgcaggtcctggagatgcacagctgctaaccgtgaaa
ggtttagctgcactgcaaaaggcagatgttattgtatacgatcgcctcgttgaaccagcg
atgctccaagaacgaaaagctagttgtaaactcatttatgtcggaaaagaaccacttcat
catccaattacccaagaggaaatcgagcaaattcttgttaaagaagctgcgacaaatgag
ctggttgttcgtctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaagga
gagacactctataaagcgggaattccatttgaagttattcctggaatcacatccgcgatt
ggtgggcttgcctacgctggaatcccagtaacacatcgtgattttgcttcgagttttcac
gtgattaccggacatttgaaaaaaggacgcgatccactagattgggaagcccttgctaga
ctggaaggtacgctcgttttcctgatgggaatgactaatttgcctaatatttgtgcgaac
ttactagaaaatggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgc
ggcaaacaattaacggttaccgggaacttacaaaacatcgaacaaaaagtagcggaatct
ggtatttcttcgccggcacttattgtcgttggtgatgtggtgagcttacgaccgcagctt
aacttctttgaggaaatgccacttttccatacaaaagtattacttccaagagcacgagct
ggaaaaagtatgctcgcggaacaaattcgcgatttaggcggagaagtaacaatgtatccc
aatattcaagtagtagatgttgtgccaacgaaaacaaaagaagaactaagcgaagtaagc
gaacttcttttcacatccaaagaagcggtagaacgattttttgattatttagcccagctt
gatttagatattcgttctctaaaaaatacccatcttaccgctattggcaaacaaacaaaa
gaagcttttagtgaaaaaggaattattccagatagtttcattaaaaggcggagcacggaa
ttaattttggagcatttaccacggttacagaaaaatgtgagcaacttaattatcggaagc
atagttgatacggcagaagttaccgcaattttagcagaagtggaagcgatggaaatgatg
ccgttatatgatatgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaa
gtttgtttctcaagttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaa
aaagccattttacaaacgaaaacaattctttccattggaaggttcacgagcgcaacgtta
gcatcattcggtatcaacaattttatcgaagccgaaagcgccacaccagagagcttaatt
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system