KEGG   Listeria monocytogenes CLIP 80459: Lm4b_01347Help
Entry
Lm4b_01347        CDS       T00898                                 

Definition
(GenBank) Putative glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmc  Listeria monocytogenes CLIP 80459
Pathway
lmc00010  Glycolysis / Gluconeogenesis
lmc00052  Galactose metabolism
lmc00500  Starch and sucrose metabolism
lmc00520  Amino sugar and nucleotide sugar metabolism
lmc00521  Streptomycin biosynthesis
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01120  Microbial metabolism in diverse environments
lmc01130  Biosynthesis of antibiotics
lmc01200  Carbon metabolism
Module
lmc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lm4b_01347
   00052 Galactose metabolism
    Lm4b_01347
   00500 Starch and sucrose metabolism
    Lm4b_01347
   00520 Amino sugar and nucleotide sugar metabolism
    Lm4b_01347
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lm4b_01347
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Lm4b_01347
Enzymes [BR:lmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lm4b_01347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CAS05111
Position
1350145..1351113
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEEKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagaaaagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgccgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaataacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcgctaccaagt
gaagattaa

DBGET integrated database retrieval system