KEGG   Listeria monocytogenes Clip81459: Lm4b_01347Help
Entry
Lm4b_01347        CDS       T00898                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:lmc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lmc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lmc00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lmc00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1350145..1351113
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEEKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagaaaagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgccgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaataacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcgctaccaagt
gaagattaa

DBGET integrated database retrieval system