KEGG   Listeria monocytogenes Clip81459: Lm4b_01446Help
Entry
Lm4b_01446        CDS       T00898                                 

Definition
aspartate kinase I
Orthology
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:lmc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lmc00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lmc00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1451913..1453124)
Genome map
AA seq 403 aa AA seqDB search
MKIIVQKFGGTSVQNEKSRLMAFNHIKQVLKEGYKVVVVVSAIGRYGDPYATDTLLELIG
AKNTKLTAREQDTLLSVGETISASVFTNMLKEANIKAEAFSGGQAGIITSDDHLNAKITE
VDTARLKDALTNLDVAVVAGFQGITANGDISTLGRGGSDTSAAALGVSLQADYIDIFTDV
DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKIPMRIRSTYLES
TGTLVTSLTNDSDHFDVKERIVTGVAHVTNLTQISVQTDSVKAQQLAFKILADAGISLDF
INISTNSVIFTVPEEKSHVVKQLLEDADLQTTVRQACAKVSIVGAGITGVPGVTAKIVGA
LSEKNIPILQSADSHTTIWVLVKEEDLISAVNALHDVFCLEIK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgtccaaaaatttggcggaacatccgtacaaaatgaaaaatcacgtttg
atggcattcaatcatatcaaacaagtactaaaagaaggatataaagttgttgttgtcgtt
tcagccattggtagatacggagatccttatgcgacagacacactattagaacttattggt
gctaaaaatacaaagctaacagcaagagaacaagatactttactctctgtaggcgaaact
atttcagcatctgtatttaccaatatgttaaaagaagcaaatattaaagcagaggcgttt
tctggtggtcaagcaggcatcattacatcagacgaccatttaaatgcaaaaatcacagaa
gtggatacagctcgtttgaaagatgcattaacgaaccttgatgtagctgtagttgctggc
ttccaaggtattactgcaaatggggatatttccacattaggacgcggaggaagtgataca
tccgcagcggctctaggagtttcgttacaagcagactatattgatatctttacagatgta
gatggaatgatgacagccgatccacgtattgtagaacacgcacgttcactaccacgagta
agttacaacgaagtaagcaatatggcgtatcaaggtgcaaaagtgatccatccacgtgca
gttgagatagcgatgactgcaaaaataccaatgcgaatccgttctacttatttggaaagc
actggaacacttgttacttcattaaccaatgattcagatcattttgacgtgaaagaacga
atagtaaccggtgtagcacatgtaaccaatttaacacaaatatccgtacaaacagattcg
gtaaaagcgcaacaactcgcttttaaaatattagcagatgcaggaatcagccttgatttc
attaacatctctaccaactctgtcatttttacggtgccagaagaaaaatctcatgtagta
aaacaactattagaagatgcagacttacaaacaactgtacgacaagcttgtgcgaaagtt
tctattgttggcgccggaatcacaggcgttcccggtgttactgcaaaaatcgttggcgca
ttatctgaaaaaaatatccctattttacaatcagcggatagtcatactactatttgggta
ttagtaaaagaagaggacttaatttcagcagtcaatgcccttcatgacgtattttgtttg
gaaattaagtaa

DBGET integrated database retrieval system