KEGG   Listeria monocytogenes CLIP 80459: Lm4b_01582Help
Entry
Lm4b_01582        CDS       T00898                                 

Gene name
pfk
Definition
(GenBank) Putative 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmc  Listeria monocytogenes CLIP 80459
Pathway
lmc00010  Glycolysis / Gluconeogenesis
lmc00030  Pentose phosphate pathway
lmc00051  Fructose and mannose metabolism
lmc00052  Galactose metabolism
lmc00680  Methane metabolism
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01120  Microbial metabolism in diverse environments
lmc01130  Biosynthesis of antibiotics
lmc01200  Carbon metabolism
lmc01230  Biosynthesis of amino acids
lmc03018  RNA degradation
Module
lmc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lm4b_01582 (pfk)
   00030 Pentose phosphate pathway
    Lm4b_01582 (pfk)
   00051 Fructose and mannose metabolism
    Lm4b_01582 (pfk)
   00052 Galactose metabolism
    Lm4b_01582 (pfk)
  Energy metabolism
   00680 Methane metabolism
    Lm4b_01582 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Lm4b_01582 (pfk)
Enzymes [BR:lmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lm4b_01582 (pfk)
Protein phosphatases and associated proteins [BR:lmc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Lm4b_01582 (pfk)
Messenger RNA biogenesis [BR:lmc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Lm4b_01582 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAS05343
UniProt: C1KVL8
Position
complement(1593905..1594864)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggtgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggccttgtggttatt
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaactattgataatgatatttctggaactgattttactattggttttgat
acagcgttaaacactgttcttgatgcacttgataaaatccgcgatacagctacaagtcat
gaacgtactttcattattgaagttatgggtcgtgacgctggtgatatcgctctttggtct
ggacttgctggtggtgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggtaaaaaacatagtattatcgtcgtt
gctgagggcgtaatgtccggtaatgaattcgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggtgcacgttcagtagaattattgttagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgaaattttg
aaagaaaaacacacacttgatcaaaaattatttgatctagcatctattttgtcgatttaa

DBGET integrated database retrieval system