KEGG   Listeria monocytogenes Clip81459: Lm4b_01631Help
Entry
Lm4b_01631        CDS       T00898                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1646281..1647693)
Genome map
AA seq 470 aa AA seqDB search
MTEINWQKEVESRKDDFLEDLKGLLRIPSVRDDSKKTEDAPFGPDVKRALDYMIELGKKD
GFTAKEVGNVAGHLEYGQGEELVGVLGHVDVVPVGDGWTNGPFEPTLRDGKLYARGVADD
KGPTIAGYYALKIIKELGLPLSRRVRIIVGSDEESGMSCVERYFETEEQPTLGFVPDAEF
PIIHAEKGISELDVSFKDGEASGEAAFHLLSVESGERYNMVPDHATAILEDVKDFDKVAS
AFKTFLANHPVEGTLEENGKSVKINIVGKSAHAMEPNNGVNAGLHLVAFLGKFKLTGAAN
DFVTFGRDYLFGDSRAVKLGISYEDEESGELTMNVGVIRYDVAEGGKYGLNFRYPVTANM
DKLKNKMQTVVYEYNAQYTHYEDSKPLFVPKDHPLIQVLQEVYTKQTGEEATLLAIGGGT
YARHMETGVAFGALFPGREDTMHQKDEFSYFDDLLKATAIYAEALYKLAK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaattaattggcaaaaagaagtggaatcacgcaaagatgatttcttagaagat
ttaaaagggcttcttcgcattccgagtgttcgcgatgacagtaaaaaaacagaagatgcg
ccgtttggaccagacgtgaaacgcgcgctcgactatatgattgaacttggtaaaaaagac
ggcttcacagcgaaagaagttggaaatgtagcaggacaccttgaatacggtcaaggagaa
gaactagttggcgttttaggccatgtggatgtagtaccagttggtgatggttggacgaac
ggaccattcgaaccaactttacgcgacggcaaattatacgctcgtggggttgcggacgat
aaaggaccaacaatcgcaggttactatgcgctaaaaattattaaagaactaggattacca
ctttctcgccgtgttagaatcattgttggttctgatgaagagagcggtatgagctgtgtg
gaacgttattttgaaacagaagaacaaccaacacttggttttgttcctgatgcagaattc
ccaatcattcacgcggaaaaaggtatctcagaactagatgtatcttttaaagatggtgaa
gcaagcggggaagcggctttccatttacttagcgtagaatcaggcgagcgttacaacatg
gttccagatcacgcaacagctattttagaagatgtaaaagactttgataaagtagcgagt
gcattcaaaaccttcctagcaaaccatccagtagaaggaacattagaagaaaacggcaaa
tccgttaaaattaatattgttggtaaatcagcccatgcaatggaaccaaataacggtgta
aacgctggtcttcatttagtagctttccttggtaaattcaagctgactggcgcggcaaat
gatttcgtaacatttggtcgcgattacctattcggcgattcccgtgcagttaaattaggt
attagctatgaagacgaagaaagcggcgaactaacaatgaacgttggcgttattcgttac
gatgtagcagaaggtggaaaatacggacttaatttccgttatccagtaactgctaatatg
gacaaattgaaaaataaaatgcaaacagtggtttatgagtacaatgcgcaatacacgcat
tacgaagattccaaaccacttttcgtaccaaaagatcatccgctaattcaagttttacaa
gaagtgtatacaaaacaaacgggtgaagaagctactttactagcaattggtggcggaact
tatgcgcgccacatggagactggtgtggcgttcggcgcactattcccaggccgtgaagac
acgatgcaccaaaaagacgaattcagctattttgatgatttgttaaaagctactgcaatt
tatgcagaagcactttacaaattagcgaagtaa

DBGET integrated database retrieval system