KEGG   Listeria monocytogenes CLIP 80459: Lm4b_01638Help
Entry
Lm4b_01638        CDS       T00898                                 

Gene name
trpA
Definition
(GenBank) Putative tryptophan synthase (alpha subunit)
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmc  Listeria monocytogenes CLIP 80459
Pathway
lmc00260  Glycine, serine and threonine metabolism
lmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01130  Biosynthesis of antibiotics
lmc01230  Biosynthesis of amino acids
Module
lmc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lm4b_01638 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lm4b_01638 (trpA)
Enzymes [BR:lmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lm4b_01638 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAS05399
UniProt: C1KVS4
Position
complement(1653747..1654520)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAKKDHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLARSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQTLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDNHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcgaaaaaagatcatgctgccgtagttacttac
attatgggtggcgatggtggcttagataatttagaagaacagttattgtttctcgaaaaa
tctggtgtaagcgcgattgaaattggtattcctttttctgatccggttgccgacggtccg
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctaggagtaaagtgcaaattccgctaattattatgagttatattaatccg
atttttcatttaggtatcccgaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattcctgatttaccttatgagcaccaaacactgattacgccagaacttcaaggg
acagatatcgcacttattccgcttgtttcattgacaagtccgaaagagcgcctcgaagaa
attgcgaaacaggcagaagggtttatttatgcagtaacagttaacggaactaccggtgtg
aggagtgaatttgatgcccatattgataaccatttagcttatttaaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtggaaaaatttgcgcat
gtatgtgatggtgtaataatcggtagtaaagtcgtgcaaatgttacatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggccgcagaagttcgaatcgaaaactaa

DBGET integrated database retrieval system