KEGG   Listeria monocytogenes CLIP 80459: Lm4b_01641Help
Entry
Lm4b_01641        CDS       T00898                                 

Gene name
trpC
Definition
(GenBank) Putative indol-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmc  Listeria monocytogenes CLIP 80459
Pathway
lmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01130  Biosynthesis of antibiotics
lmc01230  Biosynthesis of amino acids
Module
lmc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lm4b_01641 (trpC)
Enzymes [BR:lmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Lm4b_01641 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAS05402
UniProt: C1KVS7
Position
complement(1656323..1657081)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKAVEVADMPLEKVAEKRKTYSFYEFLKANTSTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVEIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEMLIALFEQALALDLEVLVEVHDQKELAVAQKIGAKLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYNAVLVGEALMREAT
PEAAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagcagtagaagttgcagacatgccctta
gaaaaagtagccgaaaaacggaaaacttattcgttttatgaatttttaaaagcaaatacc
agcacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccggttctgcaagccaagtcttatcaagctgcgggtgcaggaatgatt
tctgttttgacagatcctgtttttttcaaaggctcgattgaagatttgcgagaagtagcg
aaaaatgtcgaaattcctgtactatgtaaagattttattattagtgaaaaacaattgatt
cgtgctcgaaatgcgggagcaacggttgtattgctaattatttcggcacttacagaagag
atgctaattgctctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccagaaagaattagctgttgctcaaaaaattggagctaaactcattggtgtgaac
aaccgtaatttgcatacatttgaagtggatattgcagtaagtgaaagactggcgagcgat
ttctcgtcggatgcttgtttcataagtgaatcaggttttcgaacagctgaagatgtggct
cgggttagtcaaaaatataatgcagtacttgttggagaagcgctaatgcgagaagcgact
ccagaagcagcggcgaaaagtttgaaggtgacacgatga

DBGET integrated database retrieval system