KEGG   Listeria monocytogenes Clip81459: Lm4b_01843Help
Entry
Lm4b_01843        CDS       T00898                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lmc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1888740..1889357)
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSRE
VFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIF
IFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIK
GIVETEHLKTERVIHRYKKMLEGLQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagaggactgttaattgtactttcaggtccatctggagtaggtaagggaact
gttcgggaagctgtttttaaagatccagaaacaagttttgattattctatttccatgaca
acgcgtcttcctcgtgaaggcgaacaagacggggtcgattattattttcgttcacgagaa
gtgtttgaacaagctatcaaagacggaaagatgttagaatatgcagagtacgtcggtaat
tattacggcactccgcttgaatatgtcgaggaaaaattagccgcaggagtggatattttt
ctcgaaattgaagtacaaggagcaatgcaagttcgaaaagcgatgccagaaggaattttc
attttcttaacgccaccagatttgtctgagcttaaaaaccggattatcggtcgcggtaca
gaatcgatggaagttgtcgaggaacgcatggaaacagcgaagaaagaaatcgaaatgatg
gcgtcttatgattatgctgtggtgaatgatgtagttgcaaacgccgtacaaaaaatcaaa
ggcatcgtcgaaacagaacacttaaaaactgagcgagtaattcatcgctacaaaaaaatg
ttggagggattacaatga

DBGET integrated database retrieval system