KEGG   Listeria monocytogenes Clip81459: Lm4b_01890Help
Entry
Lm4b_01890        CDS       T00898                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lm4b_01890
   00670 One carbon pool by folate
    Lm4b_01890
Enzymes [BR:lmc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Lm4b_01890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1935276..1935758)
Genome map
AA seq 160 aa AA seqDB search
MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTI
VLTRDQGLKLDDAEILHSKEAVLALAETGETIYIVGGAEIYRLFMDVADQLIVTKIDAEF
EADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatttttgtttgggcacaagaccgcgctggtaatattggaaaagataacaaaatg
ccgtggcacttaccaggagatttgcagtttttcaaaaaaacgacgactgggaaaacactt
gtcatggggcgaaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc
gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa
gctgttttagctcttgctgagacaggggaaacaatctatatagttggtggtgcagaaatc
tatcgtttatttatggatgtggcagatcagctgattgtgacaaaaattgatgcagagttt
gaggctgatactgcgtttcctgaagtggattgggagaatttttccgaagtggcgaaagaa
ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat
tag

DBGET integrated database retrieval system