KEGG   Listeria monocytogenes Clip81459: Lm4b_02059Help
Entry
Lm4b_02059        CDS       T00898                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lmc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2119467..2120942)
Genome map
AA seq 491 aa AA seqDB search
MKLNELMQAIPVFTGEASETIEISHIAQDSRKVKPGTLFICIDGELVDGHQFASRAVELG
AVAIIAEKQLDVSIPVIYVRDSKRAMAMLADYFYGSPTQALKLVGITGTNGKTTVSHLVE
QIVRENGEQTGLIGTMYRKIGDQILETKNTTPDSLTLQETFRDMLLSGVSTAVMEVSSHA
LVQGRVYGSDYDVAVFMNLSQDHLDYHHTMEEYANAKSLLFAQLGNSYHTSNPKIAVLNA
DDEESVRMQKATAAHVITFGIKQQADFKASNIRITSHGSTFDLRTPIGNFTLKIKMIGNF
SVYNVLAAIATSFALHIPMEKAIKTVESIPGVKGRFELVHAGQEFPVIVDYAHTPDGLLN
VLETIAEFAEKRVFVVVGCGGDRDKGKRPQMAKIAVDYATNPIFTSDNPRSENPRAIIED
MIQGVPYSDSYVVHENRRDAIRFAVNEAEAGDVILIAGKGHEDYQVIGDEVIDFDDRVEA
RIAIEKKLGLA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaatgaactaatgcaagctatcccggtttttactggcgaggcaagtgaaaca
attgaaattagccatatcgcccaagatagtagaaaagtaaaaccagggacgttgtttatt
tgtatagatggagaattggtggatggacatcaatttgcatcacgtgcagtagaactagga
gcggtagcaattatcgcggaaaaacaattagatgtatcgattcctgtcatttatgtaaga
gattcaaaacgtgctatggcgatgttagccgattacttttatggatctccaacccaagca
ttaaagctcgttgggattactgggacaaatgggaagacgaccgtgagccacttagtggaa
caaattgtgcgcgaaaatggcgagcaaacaggtttgattggcacgatgtatcgcaaaatt
ggcgaccaaattttagaaacaaaaaatacaacgccagatagcctcactttacaagaaaca
ttccgggacatgttacttagtggagtgagcacagctgtgatggaagtatcctcgcatgca
ctcgttcaaggtcgcgtatatggttcagattacgatgttgctgtatttatgaatttgtct
caagatcatttggattatcatcatacaatggaagaatacgccaatgcaaaaagcttattg
tttgcgcaactaggcaacagctaccatacaagtaacccaaaaattgctgtgttaaacgcg
gatgacgaggaaagcgtgcgtatgcaaaaagcaacagctgctcatgtaatcacttttggg
ataaaacaacaagctgacttcaaagcaagtaatatcagaattactagccatggttctaca
tttgatttacggacaccaattggtaattttacattgaaaataaaaatgattggaaacttt
agtgtttataacgtattggctgcgattgcaactagctttgcgctacatatccctatggaa
aaagcaattaaaacagtggaaagcataccgggtgtcaaaggccgttttgaacttgtgcat
gcagggcaagagttccctgttatagttgattacgcccatactccagacggcttgctaaat
gtattagaaacaattgctgagtttgcagaaaaacgcgtttttgtcgttgttggttgtggc
ggggaccgtgataaaggaaaacgtccacaaatggcaaaaatcgctgtagattatgcaaca
aatcctatttttacatcagataatccgcggagtgaaaatccgcgtgcgattattgaagat
atgattcaaggtgttccatatagtgattcttatgtggttcacgaaaaccgccgagatgcg
attcgttttgcagtaaatgaagcagaagcaggggatgttattctgattgctggaaaaggt
catgaagattatcaagtgattggtgacgaggttattgattttgatgaccgagtagaagcc
cgaatagctattgaaaaaaaacttggactcgcataa

DBGET integrated database retrieval system