KEGG   Listeria monocytogenes Clip81459: Lm4b_02232Help
Entry
Lm4b_02232        CDS       T00898                                 

Definition
(RefSeq) phosphoglyceromutase 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lm4b_02232
   01230 Biosynthesis of amino acids
    Lm4b_02232
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lm4b_02232
  Energy metabolism
   00680 Methane metabolism
    Lm4b_02232
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lm4b_02232
Enzymes [BR:lmc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Lm4b_02232
Exosome [BR:lmc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Lm4b_02232
  Exosomal proteins of melanoma cells
   Lm4b_02232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299719..2300408)
Genome map
AA seq 229 aa AA seqDB search
MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRA
IKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLP
PLLEENDERQAKNDRRYQLLDTHAIPAGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAA
HGNSLRALVKFLEGIGDDEIMDLEIPTGVPLVYELNDDLKPVNKYYLDK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattaattcgtcatggtcaaagtgaatggaacaaattgaatttatttaca
ggttggcatgatgttgacttgtcacaagaaggcgttgtagaagcaatgactgcaggaaaa
agaattaaagaagcgggcttagaattcgatgttgccttcacttctgttttaacgcgagct
attaaaacacttaattatgtgttagaagaatctgaccaaatgtgggtaccagttcataaa
tcttggcgcttgaacgaacggcattatggcgcacttcaaggtcttaacaaacaagaaact
gctgaaaaatatggtgctgaccaagtacaaaaatggcgcagaagctatgacactcttcca
ccgttattagaagaaaacgacgaaagacaagccaaaaatgatcgccgttatcaactcctt
gatacacacgctattccggcaggtgaaaacttgaaagtaacattagaacgcgttattcct
tattggatggacacgattgctccagaaattaaagaaggacggcgagtagtcatcgcggcg
catggtaacagtttacgagcattagtgaaatttctagaaggtattggcgatgatgaaata
atggatttagaaattccgacaggcgtgccactagtatatgaattaaacgatgatttaaaa
ccagtaaataaatattacttggataaataa

DBGET integrated database retrieval system