KEGG   Listeria monocytogenes Clip81459: Lm4b_02232Help
Entry
Lm4b_02232        CDS       T00898                                 

Definition
phosphoglyceromutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lmc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lmc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lmc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299719..2300408)
Genome map
AA seq 229 aa AA seqDB search
MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRA
IKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLP
PLLEENDERQAKNDRRYQLLDTHAIPAGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAA
HGNSLRALVKFLEGIGDDEIMDLEIPTGVPLVYELNDDLKPVNKYYLDK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattaattcgtcatggtcaaagtgaatggaacaaattgaatttatttaca
ggttggcatgatgttgacttgtcacaagaaggcgttgtagaagcaatgactgcaggaaaa
agaattaaagaagcgggcttagaattcgatgttgccttcacttctgttttaacgcgagct
attaaaacacttaattatgtgttagaagaatctgaccaaatgtgggtaccagttcataaa
tcttggcgcttgaacgaacggcattatggcgcacttcaaggtcttaacaaacaagaaact
gctgaaaaatatggtgctgaccaagtacaaaaatggcgcagaagctatgacactcttcca
ccgttattagaagaaaacgacgaaagacaagccaaaaatgatcgccgttatcaactcctt
gatacacacgctattccggcaggtgaaaacttgaaagtaacattagaacgcgttattcct
tattggatggacacgattgctccagaaattaaagaaggacggcgagtagtcatcgcggcg
catggtaacagtttacgagcattagtgaaatttctagaaggtattggcgatgatgaaata
atggatttagaaattccgacaggcgtgccactagtatatgaattaaacgatgatttaaaa
ccagtaaataaatattacttggataaataa

DBGET integrated database retrieval system