KEGG   Listeria monocytogenes CLIP 80459: Lm4b_02676Help
Entry
Lm4b_02676        CDS       T00898                                 

Gene name
recR
Definition
(GenBank) Putative recombination protein recR
  KO
K06187  recombination protein RecR
Organism
lmc  Listeria monocytogenes CLIP 80459
Pathway
lmc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lm4b_02676 (recR)
DNA repair and recombination proteins [BR:lmc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Lm4b_02676 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lm4b_02676 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5
Motif
Other DBs
NCBI-ProteinID: CAS06430
UniProt: C1KZQ7
Position
complement(2747407..2748003)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPITKLIDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVC
GHITDKDPCYICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPE
DINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKVTRIAHGLPVGGDL
EYADEVTLSKAMEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgagccgataacgaaattaatagatagttttatgaaattaccaggaatt
ggaccaaaatcggcagctcgactagctttttatgtgttagatatgaaagaagacgatgtg
ctagattttgcaaaagcccttgttgatgcgaagcgaaacctaagcttttgttccgtttgt
ggtcacattacagataaggatccatgttatatttgcgctgatacgtcacgcgatcgaagt
gttatctgtgtagtacaagaatccaaagatgtcattgcaatggaaaaaatgcgtgatttt
catggcttataccatgtacttcatggaacaatttcgccaatggatggaattggaccagaa
gatattaacattcctgatttgctgaaacgtttgcaagatgacacaattgaagaagttatt
ttagcaaccaaccctaatgttgaaggagaagccacggcgatgtatatttcgcgcttatta
aaaccttcaggcataaaagtaactagaatagcgcatggccttccagttggcggagacttg
gaatatgcggatgaagtgacgctctcaaaagcaatggaaggacgaagagaagtataa

DBGET integrated database retrieval system