KEGG   Listeria monocytogenes Clip81459: Lm4b_02694Help
Entry
Lm4b_02694        CDS       T00898                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmc  Listeria monocytogenes Clip81459
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lm4b_02694
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lm4b_02694
   00620 Pyruvate metabolism
    Lm4b_02694
   00640 Propanoate metabolism
    Lm4b_02694
  Energy metabolism
   00680 Methane metabolism
    Lm4b_02694
Enzymes [BR:lmc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Lm4b_02694
Lipid biosynthesis proteins [BR:lmc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Lm4b_02694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2765413..2766990
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDAEGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaataaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tacatgggcttatggaaagctggtgccattatcatcccggcatccgagctacttaaagcg
cacgatttagaataccgcatccaccatgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgaccattggctcgatattcacgaagacgatatcgtttgggccacagctggtcct
ggttggcaaaaatgggtttggtctcctttcctttctgtactcggaaaaggtgccactggc
ttcatttacaacggtcgtttcattcctgaaaaacaacttcatttactggaagaagaaaaa
atcaacgtgctgtgctgtacgccaacagaatatcgcttaatggctaaagtaaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccaagataattttgatattaaagttcgcgacggctacggtcaa
acggagagtacactgttgattgggacactggttgatacgccgattcgccctggttcgatg
ggtaaaccgattatgccagaatacatggcaattattgacgctgaaggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagagtac
tataaagaaccagaacgtttgcaaaaagcgattcgcggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaaggccggaatgacgatattatt
attagctctggttacacgattggaccgttcgaagtagaggacgcgctcacacatcatcca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggtacggtcgtaaaa
gcatttatcgtcttaaaggatggttacgagggcacggaagatcttgtgcatgaattacaa
acattcacgaaagaacaaaccgctccgtataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgtcgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system