KEGG   Leisingera methylohalidivorans: METH_19140Help
Entry
METH_19140        CDS       T02961                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00071  Fatty acid degradation
lmd00072  Synthesis and degradation of ketone bodies
lmd00280  Valine, leucine and isoleucine degradation
lmd00310  Lysine degradation
lmd00362  Benzoate degradation
lmd00380  Tryptophan metabolism
lmd00620  Pyruvate metabolism
lmd00630  Glyoxylate and dicarboxylate metabolism
lmd00640  Propanoate metabolism
lmd00650  Butanoate metabolism
lmd00900  Terpenoid backbone biosynthesis
lmd01100  Metabolic pathways
lmd01110  Biosynthesis of secondary metabolites
lmd01120  Microbial metabolism in diverse environments
lmd01130  Biosynthesis of antibiotics
lmd01200  Carbon metabolism
lmd01212  Fatty acid metabolism
lmd02020  Two-component system
Module
lmd_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:lmd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    METH_19140
   00630 Glyoxylate and dicarboxylate metabolism
    METH_19140
   00640 Propanoate metabolism
    METH_19140
   00650 Butanoate metabolism
    METH_19140
  Lipid metabolism
   00071 Fatty acid degradation
    METH_19140
   00072 Synthesis and degradation of ketone bodies
    METH_19140
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    METH_19140
   00310 Lysine degradation
    METH_19140
   00380 Tryptophan metabolism
    METH_19140
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    METH_19140
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    METH_19140
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    METH_19140
Enzymes [BR:lmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     METH_19140
Exosome [BR:lmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   METH_19140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHD02456
UniProt: V9VUN8
Position
complement(3770740..3771912)
Genome map
AA seq 390 aa AA seqDB search
MKDVVIAGAARTPMGGFQGMYDGVTASELGGAAIRAALEGAGAATVDEVLMGCVLPAGQG
QAPARQAGFAAGLGEEVPATTLNKMCGSGMKAAMIAFDQIALGHAGTMVAGGMESMTNAP
YVLPKMRGGARLGHSQVIDHMFLDGLEDAYDKGRLMGTFAEDCAEKYQFTREAQDEYALK
SLANALEAQDSGAFDGEIAAVTVKTRKGEVVTDADEPPKSARPEKIPTLKPAFRKDGTVT
AANASSISDGAAALVLASAEAAAAQGLQVRARILGHASHAQAPGLFTTAPVPAAQKLLKN
IGWQVEDVDLWEVNEAFAVVPMAFMHEMGISRDKVNVNGGACALGHPIGASGARIMVTLL
NALEKRGLKRGVAAICIGGGEGTAIAIERV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgttgttatcgccggagcggcccggacgcctatgggcgggttccagggaatg
tacgacggggtgacggcttcggagctcggcggcgcggccatccgggcggcccttgaaggc
gccggtgctgccactgtcgatgaggtgctgatgggctgcgttctgcctgcgggccagggc
caggcgccggcgcgtcaggcgggtttcgccgcgggcctgggtgaggaggtgccggccacg
acccttaacaaaatgtgcggctcgggcatgaaggcggcgatgatcgcctttgaccagatc
gcactgggccatgccgggacaatggtggccggcggcatggaaagcatgaccaacgcgcct
tatgtgctgcccaagatgcgcggcggcgcccgtctcggtcatagtcaggtgattgaccac
atgttcctcgacgggctggaggatgcctatgacaagggccgcctgatgggcacctttgcc
gaggattgcgctgaaaaataccagttcacccgcgaagctcaggacgaatacgcgctgaaa
tcgctcgccaacgcgctggaagcccaggacagcggcgcatttgacggggaaattgcggcc
gttaccgtaaaaacccgcaaaggcgaggtggtgaccgatgcggatgagccgccgaaatcg
gcgcgcccggaaaagatcccgactctgaagccggcgttccgcaaggacggcactgtaacg
gcggcgaatgcctcctccatttccgacggcgcggcagcactggttcttgcctcagccgag
gctgccgcggcacagggattgcaggtccgcgcccggatcctcggccatgccagccatgcg
caggcaccgggcctgttcaccaccgcgccggttccggcggcgcaaaagctgctgaaaaac
attggctggcaggttgaagacgtcgatctgtgggaagtgaacgaagcttttgccgtggtg
ccgatggccttcatgcatgagatgggcatttcccgcgacaaggtgaatgtaaacggcggc
gcctgtgcgctgggccacccgatcggggcctccggcgcgcggatcatggtgacccttctg
aacgcattggaaaaacgcggtctcaagcgcggcgtggccgccatctgcatcggcggcggc
gagggcacggcgattgcaattgagcgggtctga

DBGET integrated database retrieval system