KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0007Help
Entry
LEUM_0007         CDS       T00411                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lme00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lme00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9403..9876
Genome map
AA seq 157 aa AA seqDB search
MSIYDYFATLENGETYSLNKLANHPVVIVNTATKCGYAPQFGELEKLYKKYKDKGLVILG
FPSNQFKQELETASQAAQACQLTYGVTFPMHQLVAVNGKNTDPLFKYLKENSKGMLGSST
IKWNFTKFLVDKEGNVVKRYAPKTEPKDLEEDIEDVL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatacgattattttgcaaccttagaaaacggagaaacttattcacttaataag
ctagccaatcatccagtagtgattgttaatactgctacgaagtgcggctatgcaccacaa
tttggtgagttagaaaaattatataagaagtataaagataagggactagtaattttaggc
tttccatctaatcaattcaaacaagagttagaaaccgcatcacaagcagcccaagcatgt
caacttacttatggtgtaacttttccaatgcatcaactagttgccgtgaatggtaaaaac
acagatcctttgtttaaatatttgaaagagaattcaaaaggaatgctgggtagtagcaca
atcaaatggaattttacaaagtttttagtggataaggagggaaacgtcgtaaaacgctat
gccccaaaaacagaacccaaggatcttgaagaagatattgaagatgttttatga

DBGET integrated database retrieval system