KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0130Help
Entry
LEUM_0130         CDS       T00411                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LEUM_0130
   00051 Fructose and mannose metabolism
    LEUM_0130
Enzymes [BR:lme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     LEUM_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
111678..113024
Genome map
AA seq 448 aa AA seqDB search
MAELFDFPQVTFVGIQSLQAGDGFHYYNPDEIVKGKKMSDWLKFSVTYWHTMDQRLVDPF
GEGTAVRPWDNQGKPDSMEQALAKVDYLFEFLEKTDVNYFAFHDRDLAPEGHTLAETNKN
LDQVIDKIEQKIHETGKKLLWNTSSLFTNKRFLAGGATTPFAEVFAYAAGQIKHSLDIAK
RLGSESYVFWGGREGYDFLLNTDTKRELDHIAAFFKLAKDYANEIGYQGQFLIEPKPKEP
TQHQYDFDVQTTIAFLKTYGLEDTFKLNLEGNHAYLAGHTYEHEVRFAREAGLLGSLDAN
MGDKLTGWDIDEFPNDVYEATLVMYEFLKNGGLPTGGLNFDSKARRQSFQADDLFYAHIA
GMDTYAAGLKVAAKLIDDQVIENVLKERYASFDSGIGADFEAGKVTLKELATYIENKTDE
EINATLKSGRQERIKQTLNNYIFSVLGS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactttttgattttccccaagtaacatttgtaggaatacaatcattacaagcg
ggtgatggatttcattattataatccagatgaaatagttaaaggtaagaaaatgagtgac
tggctaaagttttcagtgacttattggcatacaatggaccaacgcttagtagacccattt
ggtgaaggaacagcagtccggccgtgggacaatcaaggtaaaccagattcaatggagcaa
gcattagcgaaggttgattatttgtttgagtttttggaaaaaactgacgttaattacttt
gcctttcatgatcgtgatcttgcacctgaaggtcatacacttgccgaaacaaataaaaat
ttagatcaagttattgacaaaattgaacaaaaaatacatgaaacaggtaaaaaactttta
tggaatacttcatcactatttacgaataaacgttttttggctggtggcgcaactacacca
tttgctgaggtatttgcttatgcagctggacaaattaagcattcattagatattgccaag
cgcttaggatcagaatcatatgttttctggggcggacgagaaggctacgactttctatta
aatactgacaccaaacgtgaattagaccatattgcagcattctttaagctagctaaggat
tatgcaaatgaaattggttatcagggacaattcttgattgaacccaagcccaaagaacca
acacagcatcaatatgattttgatgtgcaaacaacaattgctttcttgaaaacttatgga
ttagaggatacattcaagttgaacttggaaggcaatcacgcctacttagctggtcacacg
tatgagcatgaagtgagatttgcgcgagaggctggtttgttagggtcattagatgctaac
atgggtgataagctcactggttgggacattgatgaatttccaaatgatgtttatgaggcg
accttagtaatgtatgaattcttgaaaaacgggggtctaccaactggtggtttgaatttt
gattcgaaagcacgccgtcaaagtttccaagctgacgatttgttctacgcgcatattgct
ggtatggatacttatgctgctggcttgaaagttgctgctaagctaattgatgaccaagtg
attgaaaatgttctgaaagagcggtatgcttcatttgattcgggtattggcgctgatttt
gaagctgggaaagttaccttaaaagaattggccacctatattgaaaataaaacagatgaa
gaaatcaacgcaaccctcaagtcaggtcgccaagaacgaatcaaacaaacattgaataat
tacattttttctgtacttggatcttaa

DBGET integrated database retrieval system