KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0161Help
Entry
LEUM_0161         CDS       T00411                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lme00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
144820..146316
Genome map
AA seq 498 aa AA seqDB search
MTEDIRVRYAPSPTGHLHIGNARTAIFNWLFARHYNGTFVIRIEDTDSARNIADGEKSQL
ENLAWLGLDWDESPDKPGVYGPYRQSERNEQGIYQEFIDALLASGQAYKSYKTSGQLASE
REAQQAAKQAPHYVYEYEGLTNEEREAKYAEFEAQGLKPVVRFRVPEEQVYAWDDIVKGH
IEIGAKEVGGDWVIQKADGMPTYNFAVVVDDHLMKISHVLRGDDHVSNTPKQIMIYEALG
WDVPKFGHMALIINGETGKKLSKRDENLLQFVEQYKELGYQPQAMVNFIGLLGWSPKGED
EIFSLSEFKEMFDEKRLSKANAKFDQKKLEWVNNQWMRRDTDAVMPQLIQELVNAHLISA
DDAADKKKWLSEVIKVAGVDGISYTRQIVELVRKPFFELGDITDEMVEYLTSEDGRKVAA
AWESTYESLPTDATPADYMSTIRAIQNDLEIKGRNLWNPIRIMTTHEVQGPNLPEMLTLL
DKNTVLKTMRDVKEKYLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagacatacgtgttcgctatgcgccgtcaccaacgggacatttgcatataggg
aatgcacgaacagctatttttaattggttatttgcacgccactacaatggcacattcgtt
attcgtattgaggatactgactcagcacgtaatattgctgatggcgaaaaatcacaactt
gaaaatttagcttggctaggtttagactgggatgagagtccagacaaaccaggcgtttat
ggaccttatcgtcaatcagaacgtaatgaacagggtatttatcaagaatttatcgatgca
ctattagctagtgggcaagcgtacaagtcttacaaaacgtcaggacagctcgcctctgaa
cgtgaagcgcaacaggcagctaagcaggcgccgcattatgtttatgaatatgaaggtttg
actaacgaagagcgtgaagccaaatatgctgaatttgaagcacaaggattaaagccggta
gtgcgtttccgtgtaccagaagagcaggtatatgcttgggatgacatcgttaaagggcat
atcgagattggtgctaaagaagttggtggtgattgggtcattcaaaaagctgatggtatg
ccaacttataattttgcggttgtcgttgatgaccacttgatgaaaatttcccacgttctt
cgtggagatgaccacgtctcaaatacaccaaagcaaatcatgatttatgaagctttgggg
tgggatgtgccaaagtttggacatatggctttgattatcaatggagaaactggtaagaaa
ttgtctaaacgtgatgaaaatctcttgcagttcgttgaacaatacaaggaattaggctac
caaccacaagctatggttaattttattggtttgctggggtggtcaccaaagggtgaagat
gaaatctttagtttgtcagaattcaaagaaatgtttgatgaaaagcgtttgagcaaagca
aatgctaagttcgatcaaaagaaattagaatgggtcaacaaccaatggatgcgtcgtgat
acggatgctgttatgccacaacttattcaagagctcgtcaatgctcatttgatatctgca
gatgatgctgctgataagaaaaagtggttgtcagaagttattaaagtcgctggcgttgat
ggtatatcatatacgcgtcaaattgttgagctagttcgcaaacctttctttgagttgggc
gatataacagatgaaatggttgaatacctgacttcagaagatggccgtaaagtggcagct
gcgtgggaatcaacatatgaatccttgccgactgatgcaactccggccgactatatgagt
acaattcgtgcgattcaaaacgacttagaaataaaaggccgtaacttatggaatcctatt
cgtattatgactactcacgaagtccaagggcctaatttaccagaaatgttgacattgttg
gataagaacactgttctgaagacaatgcgcgatgtgaaagaaaaatatttagcatag

DBGET integrated database retrieval system