KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0239Help
Entry
LEUM_0239         CDS       T00411                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEUM_0239
   01230 Biosynthesis of amino acids
    LEUM_0239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_0239
   00051 Fructose and mannose metabolism
    LEUM_0239
   00562 Inositol phosphate metabolism
    LEUM_0239
Enzymes [BR:lme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LEUM_0239
Exosome [BR:lme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LEUM_0239
  Exosomal proteins of bladder cancer cells
   LEUM_0239
  Exosomal proteins of melanoma cells
   LEUM_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
197957..198766
Genome map
AA seq 269 aa AA seqDB search
MSQHNASRIPFVVANWKINKLHADVAEFLDKVNGKVPAENVVETGIAAQDLFLSDMVRAT
AQSPIHIVAENVHWEDSGAYTGETSPKALKDIGAKYVLIGHFERRKFFNETDSTVNLKVT
AALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGVSVDQIRNVTLAYEPTWAIGS
GEAASAVQAQKAAHLIRQTLAKLYSPVIAEQVRVLYGGSVTPDNAREIMLQKDIDGVLVG
TSALDPEKFLQLVAIAQDPEVPEFNIENT
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacataatgcttcacgtataccttttgtagttgcaaattggaaaattaataag
ttgcacgctgatgttgcagaatttttggacaaggtgaacggtaaggtgcctgctgaaaat
gttgtggaaacaggtattgcggcacaagatttattcttgtcagacatggttcgagctaca
gcacagtcacccatacatattgtcgcagaaaatgttcattgggaagacagtggagcttac
acaggcgaaacatcaccaaaagcattgaaagatattggcgccaaatatgttttaattggg
cattttgaacgtcgaaagttttttaatgagactgattcaacagttaatttgaaagtcact
gctgcacttagaaatggcttacgcccaattatcgatgtcgatgaggatatgagtacctat
gcccagtttatggacgcggaaccctcagtggctcaagtggctgccgcgttggcaggcgtc
tctgttgaccaaatccgcaacgttacacttgcgtatgagcccacatgggcaattggatca
ggtgaggccgcaagtgcggtccaagcgcaaaaagcagctcatctgatacgtcagacgctg
gccaagttatattcacctgttattgctgaacaagttcgcgttttatatggcggatcggtg
acaccagacaacgctcgcgaaataatgttgcaaaaagatatagatggtgtgttggttggc
acatccgctcttgatccagaaaagtttctacaacttgttgccattgcgcaagatccagaa
gtcccagaatttaatattgagaatacttaa

DBGET integrated database retrieval system