KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0277Help
Entry
LEUM_0277         CDS       T00411                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LEUM_0277 (recR)
DNA repair and recombination proteins [BR:lme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LEUM_0277 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
232986..233627
Genome map
AA seq 213 aa AA seqDB search
MFNAVRVRHFENMQYPEPIAKLIDSYTKLPGIGPKTATRLAFYTLGMNEEDVQDFSKALI
SAKTDLTFCSICGNITATDTDPCVICRDQSRDQSTVFVVENSRDVMAMENTRDYHGLYHV
LNGVISPSAGTGPEDINLPSLIRRLSEHEEIKEVIVGTNANAEGEATAMYLARLLKPAGI
AVTRLAHGLAVGSDIDYADELTLIKAVQGRTKL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacgcagtgcgcgtgaggcattttgaaaatatgcaataccctgaacctatcgct
aaattaatagatagttacacgaagttacctggcattggtcccaaaacggccacaaggtta
gctttttatacattaggtatgaatgaagaagatgtgcaggatttttctaaggcattgatt
tccgcaaaaactgatttaactttctgctctatttgtggtaatattactgcaactgatacc
gatccatgcgttatttgtcgcgatcaatcacgtgatcagtcaactgtttttgttgtcgaa
aattcacgtgatgtaatggcgatggagaatacgcgagattatcacggcctatatcatgtt
ttaaatggtgttatttctcctagtgcaggaacaggaccagaggatattaatttaccaagt
ttgattcgacgtttgtctgagcatgaagaaattaaagaagtaattgtcggcactaacgcg
aatgctgaaggagaagctactgctatgtatttagcacgtttactgaaaccggctggtatc
gcagttacccgtttagcacatggtttagctgttggatctgatattgattatgctgatgaa
ctaacactcattaaagcagtacaaggacggacaaaattatga

DBGET integrated database retrieval system