KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0277Help
Entry
LEUM_0277         CDS       T00411                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LEUM_0277 (recR)
DNA repair and recombination proteins [BR:lme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LEUM_0277 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
232986..233627
Genome map
AA seq 213 aa AA seqDB search
MFNAVRVRHFENMQYPEPIAKLIDSYTKLPGIGPKTATRLAFYTLGMNEEDVQDFSKALI
SAKTDLTFCSICGNITATDTDPCVICRDQSRDQSTVFVVENSRDVMAMENTRDYHGLYHV
LNGVISPSAGTGPEDINLPSLIRRLSEHEEIKEVIVGTNANAEGEATAMYLARLLKPAGI
AVTRLAHGLAVGSDIDYADELTLIKAVQGRTKL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacgcagtgcgcgtgaggcattttgaaaatatgcaataccctgaacctatcgct
aaattaatagatagttacacgaagttacctggcattggtcccaaaacggccacaaggtta
gctttttatacattaggtatgaatgaagaagatgtgcaggatttttctaaggcattgatt
tccgcaaaaactgatttaactttctgctctatttgtggtaatattactgcaactgatacc
gatccatgcgttatttgtcgcgatcaatcacgtgatcagtcaactgtttttgttgtcgaa
aattcacgtgatgtaatggcgatggagaatacgcgagattatcacggcctatatcatgtt
ttaaatggtgttatttctcctagtgcaggaacaggaccagaggatattaatttaccaagt
ttgattcgacgtttgtctgagcatgaagaaattaaagaagtaattgtcggcactaacgcg
aatgctgaaggagaagctactgctatgtatttagcacgtttactgaaaccggctggtatc
gcagttacccgtttagcacatggtttagctgttggatctgatattgattatgctgatgaa
ctaacactcattaaagcagtacaaggacggacaaaattatga

DBGET integrated database retrieval system