KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0294Help
Entry
LEUM_0294         CDS       T00411                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LEUM_0294
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LEUM_0294
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LEUM_0294
Enzymes [BR:lme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LEUM_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
249255..250043
Genome map
AA seq 262 aa AA seqDB search
MNSWHRIVVKVGTSTIVNRDGQINYPVVNRLAQTLSSLQKSGHEILLVTSGAIGVALDQM
NLEKRPQEIPQQQALAAIGQGYLMSLYNQSFAFYQQLIGQVLLTYDVFDNKAMLENTMNA
IEMMFSQHIIPIVNENDVIAVDELDHQHSFGDNDRLAAIVTREIGADGLIILSDVDALYT
ANPNIDEFAQAIDKVTKITDDIRMSATGSTSGLGTGGMSTKLAAGEFVMKNGGKMVLING
NNPALILEVIAGKTVGTLFQGE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttggcatagaattgttgttaaagtcggcacgagcacaattgttaatcgtgat
gggcaaattaattacccagtcgttaatcggttggcacaaacactttccagtttacaaaaa
tctggtcacgaaattttattagttacatccggggcaattggtgtggcattggatcagatg
aatctagaaaaacgaccacaagaaattccacaacagcaagcattagctgccattggtcag
ggatacttgatgtcattgtacaatcaaagttttgcattctatcaacaattaattggacaa
gttttattgacgtatgatgtgttcgacaataaagcgatgcttgaaaacacaatgaatgcc
attgaaatgatgttttcacagcacatcattcccattgttaatgaaaatgatgtgattgca
gttgatgagcttgaccatcaacattcatttggcgataatgaccgcttagctgctattgtg
acacgtgaaattggtgccgatggattaattattttgagcgatgtcgacgcgttgtatacg
gctaatcctaatattgatgaatttgcacaagccattgataaggtaacgaaaattaccgat
gatattcgtatgagcgccaccggatcaacttctggtttaggaacaggtgggatgagcaca
aaacttgctgctggtgaatttgtgatgaaaaatggtggtaaaatggtgttaattaatggt
aataatccagccttgattttagaagtaatagctggtaaaacggtgggaacattatttcaa
ggagaatga

DBGET integrated database retrieval system