KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0384Help
Entry
LEUM_0384         CDS       T00411                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lme00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
336262..337740
Genome map
AA seq 492 aa AA seqDB search
MEIQNKAMLITYADSLGKNLKDVRKVLKEDIGDAIGGVHLLPFFPSTGDRGFAPSDYTRV
DSAFGDWSDVEALGEEYYLMFDFMINHISRESVMYQDFKKNHDESKYKDFFIRWEKFWAK
AGENRPTQADVDLIYKRKDKAPTQEITFDDGTTENLWNTFGDEQIDIDVNSAIAKEFIKT
TLEDMVKHGANLIRLDAFAYAVKKVDTNDFFVEPEIWDTLNEVREILTPLKAEILPEIHE
HYSIPKKINDHGYFTYDFALPMTTLYTLYSGKTNQLAKWLKMSPMKQFTTLDTHDGIGVV
DARDVLTDEEIDYASEELYKVGANVKKTYSSASYNNLDIYQINSTYYSALGNDDAAYLLS
RIFQVFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYSVDEVKEEVKRPVVAKLL
KLLSWRNNFAAFDLDGSIDVETPSDTTIKITRKDKSGENVAVLVANAADKTFTITANGEE
ILANTEADKQQL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcaaaataaagcaatgctcatcacatacgctgattcattgggtaaaaacttg
aaggatgttcgcaaagtcttgaaagaagatattggtgatgcaattggtggtgttcacttg
ttgccatttttcccatcaacgggagaccgcggttttgcaccttctgattacacacgtgtt
gattcagcatttggtgattggagtgatgtagaagcattaggtgaagaatattacttgatg
tttgatttcatgattaaccatatttcacgtgaatctgttatgtatcaagatttcaagaag
aatcatgatgaatcaaaatataaggatttcttcattcgctgggaaaagttctgggccaag
gctggtgaaaaccgtccaacacaagccgatgttgacttgatttacaagcgtaaggataag
gcaccaactcaagaaattacttttgatgatggtacaactgaaaacttgtggaacacattt
ggtgatgaacaaattgatatcgatgtaaactcagctatcgctaaagaatttatcaagaca
acgcttgaagacatggtgaagcatggagctaacttgattcgtttggatgcctttgcatac
gctgttaaaaaagttgatacaaatgacttcttcgttgaacctgaaatctgggatacattg
aacgaggttcgtgaaattttgacacctttgaaggccgaaattttgccagaaatccatgaa
cactattcaattcctaagaagatcaatgatcatggttacttcacatatgattttgctttg
ccaatgacgacactttatacattgtattcaggtaaaacaaatcaattggctaaatggttg
aagatgtcaccaatgaagcaatttactactttggatacgcacgacggtataggtgttgtt
gatgcgcgtgacgtcttgactgatgaagaaattgattatgcatctgaagagttatacaaa
gttggtgctaacgtgaagaagacttactcttctgcttcatacaacaacttggatatctac
caaatcaactcaacatattactcagctttgggaaatgatgatgctgcgtacttgctaagc
cgtatcttccaagtgttcgctcctggtattccacaaatctactatgttggtttgttggcc
ggtgaaaatgatattgaattacttgaatcttcaaaagaaggtcgtaacatcaaccgtcat
tactactcagttgatgaagttaaggaagaagttaagcgcccagttgttgctaagttgttg
aagcttttgtcatggcgtaacaactttgctgcatttgatttggacggatcaattgacgtt
gaaacaccatctgatacaactatcaagattactcgtaaggataagtctggtgaaaatgtt
gcagtcttggttgccaacgctgccgataagacattcacaatcactgcaaatggtgaagaa
atcttagccaacacagaagctgataagcaacaattgtaa

DBGET integrated database retrieval system