KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0527Help
Entry
LEUM_0527         CDS       T00411                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:4.2.99.18 3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lme03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
493320..494153
Genome map
AA seq 277 aa AA seqDB search
MPELPEVETVRRGLEKLIIGSKIIDVQLPYPKVITGDGQQFITGVMNTEFKQIDRRGKYL
LLRLANNHTIVSHLRMEGQYSVESLETVPYKHTEIVFELSDKRALFYNDTRRFGRMALTT
TGFENTEVPSLSKLGPEPTEEQLTLSYMMAIFSKSRRPVKTFLLDQTQIAGIGNIYADEV
LWQSKIHPKTPANVLDEVQLSVLRANIISEIKRAIKHHGTTVHSFSNVFGEVGKFQNELQ
AYGHAGEPCLRCNTPMVKIKVGQRGTTFCPFCQVEKD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactaccagaagttgaaacagtcagacgtgggcttgaaaaactaattattggc
agcaaaattattgatgtacagttaccttacccaaaagttattactggtgatgggcagcag
ttcatcaccggtgtcatgaacacagaatttaaacaaattgatcgtcgtggtaaatattta
ttactacgtttagcgaataatcatacgattgtttcgcacttacgaatggaagggcaatat
tcagtagagtcccttgagacggtcccttataaacatacagagattgtctttgaattatct
gataagcgagctttgttttacaatgacacgagacgctttgggcgcatggcgttgaccaca
actggttttgaaaacacagaagtgccttcgttgtccaaattaggaccagaaccgacagag
gagcagctgactttatcttatatgatggccattttttcaaagtctagaaggcctgttaaa
acatttttattggatcaaacacaaatagctggtattggtaatatttatgctgatgaggtt
ctgtggcaaagcaaaattcatcccaaaacgccggccaatgtactagatgaagttcaactg
agtgttcttagagcaaacatcatttcagaaattaaacgagcgattaagcatcacggtaca
acagtgcatagttttagtaatgtttttggtgaggtgggcaagtttcaaaatgaattacag
gcgtatgggcatgctggcgaaccatgtttacgttgcaatacgccaatggttaaaataaaa
gttggtcaacgtggcacgacattttgtccattttgtcaagtggagaaggattaa

DBGET integrated database retrieval system