KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0616Help
Entry
LEUM_0616         CDS       T00411                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LEUM_0616 (ruvA)
Enzymes [BR:lme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LEUM_0616 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
584604..585194
Genome map
AA seq 196 aa AA seqDB search
MYEYINGLITNITPSYIVIASRSGVGYRLYSANPYRFEENVESHVYVQQIVRENDISLYG
FIDADEKALFNKLLNVSGIGPKSALAILANGDAEGLISAVENDNVAYLTQFPGVGKKTAQ
QIVLDLKGKLDELASKTGMVDSSSNPEQSQALDDALEALLALGYTAKDVKAVAQIIGRNS
DTTDGYIRSALKLLVK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagtatattaatgggctaatcacaaatatcacaccatcgtatattgtgattgca
tcccgaagtggcgtgggatatcgcctgtacagtgctaatccttatcgttttgaggagaat
gtggaatcgcatgtctatgtacagcaaattgttcgtgaaaatgacatcagcttatatgga
tttattgatgctgatgagaaagccttgtttaataaactattaaatgtgtcagggattggg
cctaaaagtgccttagccattttggcaaacggggacgccgagggtcttattagtgcagtt
gaaaatgataatgtggcttatttgacacaattccctggtgtcggaaagaaaacggcgcag
caaattgttttggatttgaaagggaagttagatgagttagcatctaaaacaggtatggtt
gattcttcaagcaatccagaacaatcgcaagccttggatgatgcgcttgaagcactatta
gcacttggctacacagctaaagatgtgaaagcggtcgctcagattattggtcgtaatagc
gatactacagatggatatattcgctcagctttaaagctgttggttaaataa

DBGET integrated database retrieval system