KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0676Help
Entry
LEUM_0676         CDS       T00411                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEUM_0676
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_0676
   00052 Galactose metabolism
    LEUM_0676
   00500 Starch and sucrose metabolism
    LEUM_0676
   00520 Amino sugar and nucleotide sugar metabolism
    LEUM_0676
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LEUM_0676
   00524 Butirosin and neomycin biosynthesis
    LEUM_0676
Enzymes [BR:lme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LEUM_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
643209..644174
Genome map
AA seq 321 aa AA seqDB search
MAKDKLIGVDLGGTTIKFAILTDQGEIQQKWSIKTNILDDGAHIVPDIVESINHHLDLYQ
LDKERIIGIGMGTPGTVNRETGTVTGAFNLNWKTEQPVKADIEAGTGFTLTIDNDANSAA
LGEAWKGAGNNDDEVSFITLGTGVGGGLLANGQLIHGTVGAGGEVGHMIVEPDGYLCTCG
NRGCLEQYASATGVVHLAQNIAEEYVGSSKLKKMIDNGEEVTSKIVFDLAKQGDFLANKV
VDKVAYYLGYATATMSNILNPSAVVIGGGVAAAGEFLRARVEEHWTKFAFPTVRHSTRVK
LAELGNDAGVIGAASLARITA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagataaacttattggcgttgatcttggtggtacaactatcaagtttgcaatt
ttaactgatcaaggtgaaattcaacaaaagtggtcaattaaaacaaacattttggatgat
ggtgcacacattgttccagatatcgttgaatccattaatcatcatttagacttataccaa
ttggataaagaacgcatcattggtattggtatgggtacaccgggaactgttaaccgtgaa
acaggtacagtcacaggcgcctttaacttaaattggaaaacagaacaacctgtcaaagca
gatattgaggcaggaactggatttactttgacaattgataacgatgctaactctgctgct
cttggcgaagcatggaagggtgctggtaataatgatgatgaagtttcattcattacctta
ggtaccggtgtcggtggtggattgttagccaatggtcagctaatccacggtacagttggt
gccggcggagaagtcggtcacatgattgttgaacctgatggatacttgtgcacatgcggt
aatcgtggctgcttagaacaatatgcttcagctactggtgttgttcatttggcacaaaat
attgctgaagaatatgtaggtagttcaaaattaaagaagatgatcgacaatggagaagaa
gtcacatcaaaaattgtctttgatttagcaaaacagggcgactttttggcaaataaagtt
gttgacaaagtggcttactatttgggttatgccacagctactatgtctaatatcttgaat
ccatcagccgttgttatcggtggtggtgttgctgctgctggcgagttcttgcgtgcacgt
gttgaagaacattggaccaagtttgctttcccaacagttcgtcactctacacgtgtaaag
ttagcggagttaggtaacgatgctggtgtgattggtgcggcgagtctagctcgaataact
gcttaa

DBGET integrated database retrieval system