KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0691Help
Entry
LEUM_0691         CDS       T00411                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LEUM_0691
Enzymes [BR:lme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LEUM_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
662733..663644
Genome map
AA seq 303 aa AA seqDB search
MTKNIVVLGSLNVDNIMKMPRMPLVGETMALTEVTTAPGGKGANQAVAASRQGANVSFIG
AVGNDANGQFMRATLLTNGVNVDAVSTNSDVPTGSAYIMLQESGANTILIHGGANQALTI
EDINTALIAQADVLIAQFEVPFEVILAAFKIAKKNNVQTILNPAPAVYELTPELMAVTDI
VLPNETEAQLLTGINVINDEGVLNRVSDALQAKGVQRSIITLGEAGSFIADGQKRWWVQP
EKVDAQDTTAAGDTFIGTLASVIAPDFSNLDDAVQRANIASAIAVTRPGAIPSIPTDKEV
DNY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaacattgtcgtactcggcagcttgaatgtcgataatattatgaaaatgcca
cgtatgccactggttggtgaaacgatggcacttactgaagtaacaacagcaccaggtggt
aaaggggctaatcaggcagttgccgcatcacgacaaggagcaaatgtttcatttatcggt
gctgttgggaatgatgcaaatgggcagtttatgagagcaacattactcaccaatggtgtc
aatgtggacgcagtgtcaacaaatagtgatgtgccaactggatcagcatacattatgttg
caagagagtggtgcaaacacaatattgattcatggtggggcaaaccaagccttaacgatt
gaggacataaatacagcgttaattgcgcaagctgatgtgctaatcgcacaatttgaagtg
ccgttcgaagttattttggcggcatttaaaattgctaaaaaaaataatgtgcaaacaatc
ctaaatccagctccggctgtgtatgaacttactccagaattaatggctgtcactgatatt
gtgctgcccaatgaaacagaagcgcaattactgacgggcatcaatgttattaatgacgag
ggtgttttaaaccgagttagcgatgccctacaagcgaagggagtccaacggagtattatc
acattaggagaagcgggatcatttatcgctgatggtcaaaaaagatggtgggtacaacct
gaaaaggtagacgcacaagatactaccgcggcaggtgacacttttattggtacattagcc
agcgtcatagcacctgattttagtaatttagatgatgctgtgcagcgggccaacattgct
agcgcaatcgctgtaacacgtccaggtgctattccttcaattcctacagataaagaggtt
gataactattga

DBGET integrated database retrieval system