KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0696Help
Entry
LEUM_0696         CDS       T00411                                 

Definition
ATP-dependent RecD/TraA family DNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LEUM_0696
Enzymes [BR:lme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LEUM_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
667521..669908
Genome map
AA seq 795 aa AA seqDB search
MAYPEKQLDKITGTLQNVIFSSTESYFKILSVHIEESTLEDWQEPEMIATGTFADVQEGS
VYGFYGQLVRHPKYGQQFKVDHYENELPPDENGLIKYFASGQFTGIGKKTAEKIVNHLGL
NAVNLILDDAKILDGIVKAETARKLARTLRLNLGLERLFQIGNQFGIGADIAGRLYDQYG
NEAQDILTQDPYRLVFEFDGISFKKADDIGHKVGVDKFDERRMQAAVYATIMNVTFQYGH
MFLSHDQLLLSVEQMLHQNNTEMSNQIQKAIQSLIESNILVNDDGRYYAKRLYIAEKETA
INLKRLLNTSSPLNITANDIDESFVTPGKMTLDQIQVEAVKTGLKSQIFLLTGGPGTGKT
TIIRTMVATWKKMIQNRAKFADNTKDFLKNYQVRMASPTGRAAKRMTEVTGYDASTIHRL
LGIADLDEPEFNADNPIAGGLLIIDEASMLDIELTSKLLAAVPNGMKVIIVGDSDQLPSV
GPGNVLEDLVSSGDITHIELEVIYRQGRGSSITELATHIKNGELPADFLENQPDRSSFMV
NSEQASQAIEQVVALAIKKGYTQDDLQILTPMYKTSAGVIALNQMAQKLFNPLKSNQKSL
QFGMTIFRKGDKVLQLENDSERDVYNGDMGKIIAVQYKSDIGNDDNEDRLIIDFDGKELA
YPKKNLNQLSLAYATTVHKAQGNEFQLVIMVLTNHFGLMLNRNLLYTGITRAKEALILVG
EYTAFERASRTLVPKRFTFLQQRLSHSKTEVNEHDSSDESETIPEKTPHLTTTMVISSAV
NPMIGMENITPYDFM
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcatacccggaaaaacaattagataaaataactggcacgttacaaaatgttattttt
tcatcgacagaatcctattttaaaattttgtcggtacatattgaagaatcaactttagaa
gattggcaagagccagaaatgattgccactggaacatttgctgacgtccaagaaggaagt
gtatacggattttatggccaattggttcgacatccaaagtacggacagcaatttaaagtc
gatcattacgaaaatgaactgcctcccgatgaaaacgggttgattaagtattttgctagt
ggccaatttactggaattggtaaaaaaacggctgaaaaaattgttaatcatttgggattg
aatgctgtcaatctaattctagatgacgcaaaaattcttgacggtattgtaaaagcagaa
acagctcgaaaactggcgcgtacgttgcgacttaacttaggtctagaacgcttgttccaa
attggcaatcaatttggtattggtgcggacattgccggacgtttatatgatcaatacggt
aacgaggcacaagacattttaacgcaagatccttaccgtttagtatttgaatttgatggc
attagttttaaaaaagccgatgatattggtcataaggttggtgtagataaattcgatgaa
cggcgtatgcaagccgctgtttacgcaacaattatgaatgtgacgtttcaatatggtcat
atgtttttatcacacgatcaactattattgtcagtcgagcaaatgttgcatcaaaacaat
accgaaatgtcgaatcaaattcaaaaggccatccagagcttaattgaaagcaatattttg
gttaacgatgatggccgttattatgcgaaaaggttgtacattgctgaaaaagaaacggct
attaacttaaaacgattattaaatacaagttctccattgaatataacagcaaatgatatt
gatgaatcatttgtgacgcctggaaaaatgacgctcgatcagatacaagttgaggcggtt
aaaactgggttgaaatcacaaattttcttgttaacaggtggaccaggaactggaaaaacg
acaattatccgcacaatggtcgccacttggaagaaaatgattcaaaatcgtgcaaagttt
gcagacaatactaaagattttctcaaaaattatcaggtcagaatggcttcaccaacagga
cgtgcagcaaagcggatgactgaggtaacgggttatgatgcttcgacaatccatcggcta
ctgggtattgctgatttggatgagccagagtttaatgcggataatcctatcgcaggcggt
ctactaataatagatgaagcgtcgatgctagatattgaattaacttcaaaattgctagca
gcggttccaaatgggatgaaggtaattatcgtcggagatagcgatcaactaccgtcggtt
ggaccaggcaatgtattagaggatttagtgagtagcggagatatcactcatattgaatta
gaagttatctatcgacaaggccgtgggagcagcattactgaacttgcaacgcatattaaa
aacggtgagttaccagcagatttcttagagaatcaaccagatcgttcgagttttatggta
aattcagagcaagcttcgcaagcaattgaacaagtggttgcattggcgattaaaaaaggt
tacacgcaagacgatttacaaatattaaccccaatgtacaaaacatctgccggtgtaatt
gccttaaatcaaatggctcaaaaattgttcaatccgcttaaatcaaatcaaaaaagtttg
cagtttggaatgacaattttccgaaagggtgataaggtcttacagctagaaaatgacagc
gagcgagatgtttataacggagatatgggcaaaataattgctgtccagtacaagtctgac
attggcaatgatgataatgaagatcgcctcatcattgattttgatggtaaagaattggct
tatcccaaaaaaaatttgaatcaactgtcattagcgtacgctacgaccgtccataaagca
caaggtaacgagtttcaattggttatcatggttttgacaaatcattttggtttaatgctt
aatcgaaatttattatatacaggaattaccagagccaaagaggctttgattcttgtggga
gaatacaccgcatttgaacgtgcttcacgcacactggtgccgaaaagattcacattcctg
caacaaaggttgagtcacagcaaaactgaagttaatgagcacgatagttcagatgaatcg
gaaactatccctgaaaaaacacctcatttgacaacaacaatggttattagtagtgcggtt
aatccgatgatcggaatggaaaatattaccccatatgatttcatgtaa

DBGET integrated database retrieval system