KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0735Help
Entry
LEUM_0735         CDS       T00411                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lme00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lme00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
710809..712281
Genome map
AA seq 490 aa AA seqDB search
MRLTTETIQNLLVDHNLLLDAPDVDMTFDFLHYDTREVQKNTLFVIKGAFKRAYLDNVHG
ITGLITETKIDVDLPQWQVTNVQKALSLLSMAFFDYPQEQLWIGAFTGTKGKTTAAYFAY
TMLKEATNNHTALFSTVDRITGPQASDKKKSDLTTPESYELFKDMRQVVDNGMTHLVMEV
SSQAYLKNRVYGLRYDVGAFLNISPDHIGPNEHPTFEDYLAHKLMLLDHSDEVIVNAETD
HFDTIYTYAKKAHHKVYTYSRQMFTSEESAIHESRFTVVKSEFNEMLGSYRLNVPGDFNE
SNAMAAMMLVSFAGVKHQAMVKGLDEVFIPGRMLSLPINGHGVAFVDYAHNFVSMQALLS
FAQAQYPNGRVLVVVGSPGNKGVSRRADFGHVVSDLADVVYLTADDPQFENPLDIAHEIA
AHINNDKLEVHYEMNRIAAIHEAISAANENDIVIVAGKGEDPYQKIDGVDVPYIGDYAVV
KQFRDQIKNP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagattaacaactgaaacaattcaaaatttattagtggaccataatctattattagat
gcaccagacgttgatatgacgtttgatttcttacactatgatacccgagaagtacaaaaa
aatactttatttgttattaagggcgccttcaaaagggcttacttggataatgtacatggt
attacaggattaattacagaaacaaaaattgatgttgatttaccgcagtggcaagtaacg
aatgttcaaaaggctttatccttgttatcaatggctttttttgactatccgcaggagcag
ctatggattggtgcttttacaggtaccaaaggtaaaacgactgctgcttattttgcctat
acaatgctgaaagaggcaactaataatcatacagccttattttctacagttgatcgcatt
actggtccgcaagcatccgacaagaaaaagtctgatttaacaacacctgagtcatatgaa
ttgtttaaagatatgcgtcaagttgttgataatggtatgactcaccttgtgatggaggtg
agttcacaagcatatcttaaaaatcgtgtttatggactacgctatgatgtgggcgccttc
ttgaatatctccccagatcatattggccctaatgagcacccaacatttgaagattatttg
gcacacaagttgatgttactagatcactcagatgaggtgattgtcaacgctgaaacagac
cattttgatactatttacacctatgctaaaaaagcacatcataaggtctacacatacagc
cgtcaaatgtttacttctgaagaaagtgccattcatgaaagtaggttcacagttgttaag
agtgaattcaacgagatgcttggttcgtatcgtttaaatgttccaggagacttcaatgag
tcaaacgcaatggcagcaatgatgttggtttcttttgctggtgttaagcatcaagccatg
gtaaaaggattagatgaagtgtttattcccggccggatgcttagtttgccaattaatgga
catggggttgcttttgttgattatgctcataattttgtctccatgcaggccttacttagc
tttgcgcaggcccagtatccaaatggtagagtgcttgttgtagttggctccccaggtaat
aaaggtgtttcgagacgtgctgattttggacacgtagtgagcgatttggctgatgtagtt
tatttaaccgctgatgatccacaatttgaaaacccattggatattgcacatgagattgcc
gcgcatatcaataatgataaattagaggtgcattatgaaatgaatcgtattgcagccatt
catgaagcaatttctgctgcaaatgaaaatgatattgttattgttgctggcaagggtgaa
gatccttatcaaaaaatagatggtgttgatgtgccttacattggcgattatgccgttgta
aaacaatttagagatcagataaagaacccgtaa

DBGET integrated database retrieval system