KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0739Help
Entry
LEUM_0739         CDS       T00411                                 

Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00010  Glycolysis / Gluconeogenesis
lme00020  Citrate cycle (TCA cycle)
lme00620  Pyruvate metabolism
lme01100  Metabolic pathways
lme01110  Biosynthesis of secondary metabolites
lme01120  Microbial metabolism in diverse environments
lme01130  Biosynthesis of antibiotics
lme01200  Carbon metabolism
Module
lme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_0739
   00020 Citrate cycle (TCA cycle)
    LEUM_0739
   00620 Pyruvate metabolism
    LEUM_0739
Enzymes [BR:lme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LEUM_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PTS_EIIA_1 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABJ61849
JGI: LEUM0739
UniProt: Q03Y73
Position
715502..716797
Genome map
AA seq 431 aa AA seqDB search
MTEIFKMPDIGEGMAEGDITSWLVKVGDTIAADDPVAEVQNDKLMQEILSPYGGKVTKLF
VDAGTTVEVGDPLIEFDGDGSSENDSDNGHVAQPSTSSNVVETEQSTPKNTAPKETSTVQ
VANGHVLAMPSVRHLAHEKNIDLTQVPATGRHGHVTLADVENFQGSDNSAPTQTQTSTTS
QTESSAAVHEEPTPALPLREGRQPMAPVRKAIARAMDRQAAIPTVTNFDSVDVRKLVGHR
KAFKEMARDDKGIRLTYLAYAVKALAAVAKKFPELNASVDMKAQEIVYHDDVNMGIAVDA
PTGLFVPVIKNADRKSIFTIAQEITDLAEAVRDGSITPAQMQGGTITISNLGSARGTWFT
PIINGKEVAILGLGSILKEPIVNDDGELAVGQNMKLSLTYDHRLIDGMLGQSALNYLKQL
LSDPAYMLMEV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaagatgccagatattggcgaaggtatggcggagggagatattact
tcttggctggttaaagttggtgatacgatagcggctgatgatccagtcgcagaagtacaa
aatgataaattgatgcaagaaattttgtctccgtatggtggtaaagttacaaaacttttt
gttgacgccggaacaacagttgaagttggcgatccattaattgagtttgatggagacggc
agcagtgaaaatgactctgataacggtcatgtagcgcaaccaagtacttcttcgaacgta
gtggagacagagcaaagcaccccaaaaaacacagctccgaaggaaactagcactgttcaa
gtagcaaacggtcatgtgctggcaatgccatcagtacgtcatttggctcatgagaaaaat
atagatttaacacaagtaccagctactggtcgccatggtcatgttacattagcagacgtt
gaaaatttccagggatcagacaattcagcacccactcaaacgcaaacatcaaccacatct
caaacagagtcgtctgcagctgttcatgaggaaccaacaccagcattaccattgcgtgaa
gggcgtcaaccaatggcaccagtacgtaaagcgatagctagagcgatggataggcaagca
gctattccaacagtaacgaattttgattctgttgatgttagaaaattggttggccaccgt
aaggcgtttaaggaaatggctcgagatgacaaaggcatacgtttaacatacctagcctat
gctgttaaagcgttggcagctgtagctaagaaattcccagaattaaatgctagtgttgac
atgaaggcgcaagaaattgtttatcacgatgatgttaacatgggtatcgctgtggatgcg
ccaactgggttgtttgtgccagtcattaagaatgcagatcgaaagtctattttcacaatt
gcgcaagaaataactgatcttgctgaagcagttcgtgatggatcaattacacctgcccaa
atgcagggcggaacaatcacaatttctaaccttggttcggcccgaggtacttggtttaca
ccaattattaacggtaaagaagtagcaatattgggactaggttcgatcttaaaggaacca
attgtcaatgacgatggagagctagccgtgggccaaaacatgaaattatcattgacctat
gatcatcgtttgattgatggtatgctaggacaatcggcccttaattatttgaagcagcta
ttgtctgacccagcctatatgttgatggaggtgtaa

DBGET integrated database retrieval system