KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0739Help
Entry
LEUM_0739         CDS       T00411                                 

Definition
acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEUM_0739
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_0739
   00020 Citrate cycle (TCA cycle)
    LEUM_0739
   00620 Pyruvate metabolism
    LEUM_0739
Enzymes [BR:lme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LEUM_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
715502..716797
Genome map
AA seq 431 aa AA seqDB search
MTEIFKMPDIGEGMAEGDITSWLVKVGDTIAADDPVAEVQNDKLMQEILSPYGGKVTKLF
VDAGTTVEVGDPLIEFDGDGSSENDSDNGHVAQPSTSSNVVETEQSTPKNTAPKETSTVQ
VANGHVLAMPSVRHLAHEKNIDLTQVPATGRHGHVTLADVENFQGSDNSAPTQTQTSTTS
QTESSAAVHEEPTPALPLREGRQPMAPVRKAIARAMDRQAAIPTVTNFDSVDVRKLVGHR
KAFKEMARDDKGIRLTYLAYAVKALAAVAKKFPELNASVDMKAQEIVYHDDVNMGIAVDA
PTGLFVPVIKNADRKSIFTIAQEITDLAEAVRDGSITPAQMQGGTITISNLGSARGTWFT
PIINGKEVAILGLGSILKEPIVNDDGELAVGQNMKLSLTYDHRLIDGMLGQSALNYLKQL
LSDPAYMLMEV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaagatgccagatattggcgaaggtatggcggagggagatattact
tcttggctggttaaagttggtgatacgatagcggctgatgatccagtcgcagaagtacaa
aatgataaattgatgcaagaaattttgtctccgtatggtggtaaagttacaaaacttttt
gttgacgccggaacaacagttgaagttggcgatccattaattgagtttgatggagacggc
agcagtgaaaatgactctgataacggtcatgtagcgcaaccaagtacttcttcgaacgta
gtggagacagagcaaagcaccccaaaaaacacagctccgaaggaaactagcactgttcaa
gtagcaaacggtcatgtgctggcaatgccatcagtacgtcatttggctcatgagaaaaat
atagatttaacacaagtaccagctactggtcgccatggtcatgttacattagcagacgtt
gaaaatttccagggatcagacaattcagcacccactcaaacgcaaacatcaaccacatct
caaacagagtcgtctgcagctgttcatgaggaaccaacaccagcattaccattgcgtgaa
gggcgtcaaccaatggcaccagtacgtaaagcgatagctagagcgatggataggcaagca
gctattccaacagtaacgaattttgattctgttgatgttagaaaattggttggccaccgt
aaggcgtttaaggaaatggctcgagatgacaaaggcatacgtttaacatacctagcctat
gctgttaaagcgttggcagctgtagctaagaaattcccagaattaaatgctagtgttgac
atgaaggcgcaagaaattgtttatcacgatgatgttaacatgggtatcgctgtggatgcg
ccaactgggttgtttgtgccagtcattaagaatgcagatcgaaagtctattttcacaatt
gcgcaagaaataactgatcttgctgaagcagttcgtgatggatcaattacacctgcccaa
atgcagggcggaacaatcacaatttctaaccttggttcggcccgaggtacttggtttaca
ccaattattaacggtaaagaagtagcaatattgggactaggttcgatcttaaaggaacca
attgtcaatgacgatggagagctagccgtgggccaaaacatgaaattatcattgacctat
gatcatcgtttgattgatggtatgctaggacaatcggcccttaattatttgaagcagcta
ttgtctgacccagcctatatgttgatggaggtgtaa

DBGET integrated database retrieval system