KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0757Help
Entry
LEUM_0757         CDS       T00411                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00670  One carbon pool by folate
lme00790  Folate biosynthesis
lme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LEUM_0757
   00670 One carbon pool by folate
    LEUM_0757
Enzymes [BR:lme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LEUM_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 DUF4024
Motif
Other DBs
NCBI-ProteinID: ABJ61866
JGI: LEUM0757
UniProt: Q03Y56
Position
735573..736070
Genome map
AA seq 165 aa AA seqDB search
MTKIKMVWAEDRQHAIGKDGGIPWHMPDDLKLFRDETVNTLMIMGRPTWLSIGRPLPKRT
TVVMTRQEDWTPSYPEVKVIHSIEEAKNLIAKEERDITIAGGAAVYREFMPYATDLVITR
VDGVIDGDTFVDEVDLTQFQLKSSEPHAKDDNHDYAFVVERYERI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaattaaaatggtatgggctgaagatcgtcaacatgcaattggaaaagatggt
ggtataccttggcatatgcctgatgatctcaaactgtttagagatgaaacagtcaatacc
ctaatgattatggggcgcccaacgtggcttagcattgggcggccattgcctaaacgaaca
actgtagttatgactaggcaagaagactggacaccaagttatccagaagtaaaagttatt
cattccattgaagaagccaaaaatttgatagctaaggaagagcgagatattacgattgct
ggtggcgcagcagtttaccgtgaatttatgccctatgcaacagatttagttataacgcga
gttgacggtgtgattgatggcgatacttttgttgatgaggtggatttaacacaatttcaa
ctaaagtccagtgaaccacatgcgaaagatgataatcatgattacgcattcgttgtcgaa
cgctacgaacgcatataa

DBGET integrated database retrieval system