KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0783Help
Entry
LEUM_0783         CDS       T00411                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEUM_0783
   01230 Biosynthesis of amino acids
    LEUM_0783
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_0783
  Energy metabolism
   00680 Methane metabolism
    LEUM_0783
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEUM_0783
Enzymes [BR:lme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LEUM_0783
Exosome [BR:lme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LEUM_0783
  Exosomal proteins of melanoma cells
   LEUM_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
759894..760427
Genome map
AA seq 177 aa AA seqDB search
MRHSIRDDKIKDDYSAPLTIEGKQLAHDLVGYFVDKNIKAIYSSPYQRALQTIEPTATTL
GIEINLNAALRERQTNDQIDWQNHLEKLWQNFYFKTAGEESLATVQQRMKTAFYQIIDES
SGEIIITSHGTALSLLFHYLTSGYFNFIDWQKMEMPDVYIGLFDENNQCISLTKEAY
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcatagcattcgtgatgataaaattaaagacgattattcggcaccattaacgata
gaaggaaagcagttggcccatgatttggtgggttattttgtagacaaaaatattaaggct
atctattcatcaccttatcagcgtgcgttgcagactattgaaccaacagcaactacactg
ggtatagaaattaatttgaatgctgcattgcgcgaacggcaaactaatgaccaaatagat
tggcaaaatcatttagaaaagctgtggcaaaatttttattttaaaaccgctggggaagaa
tctttagcaactgtgcaacaaagaatgaaaacagctttttatcaaattattgatgaatct
tctggtgaaataattattacaagtcatgggacggcattaagcttattgttccattactta
acaagtggttatttcaattttatagactggcaaaaaatggaaatgccggatgtatatatt
ggcctatttgatgaaaataatcaatgcatcagtttaacaaaagaggcgtattaa

DBGET integrated database retrieval system