KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0787Help
Entry
LEUM_0787         CDS       T00411                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00260  Glycine, serine and threonine metabolism
lme00750  Vitamin B6 metabolism
lme01100  Metabolic pathways
lme01110  Biosynthesis of secondary metabolites
lme01120  Microbial metabolism in diverse environments
lme01230  Biosynthesis of amino acids
Module
lme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEUM_0787
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LEUM_0787
Enzymes [BR:lme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LEUM_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF148 HNH_5
Motif
Other DBs
NCBI-ProteinID: ABJ61896
JGI: LEUM0787
UniProt: Q03Y26
Position
764121..765578
Genome map
AA seq 485 aa AA seqDB search
MNYVSTRGQAPAVTSSQAIINGIAPDGGLYVPEKWPKLKLDWKNLSQQSYQEIATQVFDA
FFDDFTVQEIDHIISKSYGNQWDAESIVTLHNENKLHYIELFHGPTLAFKDVALQALPHL
LTTAAKKQSLNDKIVILTATSGDTGTAAMSGFANVENTEIVVFYPEVGVSDIQRQQMQTE
EGHNAHVTAITGNFDDAQKAVKSILSDEKLIQELSEKGMRFSSANSINIGRLVPQIVYYI
YAYAQLVKNDVVVPGEEINIDVPTGNFGNVLASYYASQLGLPVHQFTVASDENNVLTDFF
NTGIYDRQRDFKVTNSPAMDILVSSNLERLLYFASGRNDEEVRQYMKSLAENGQYTLTDK
TRNYLQKFTAKFATQSQVVDTIKDVFENSGYLIDPHTAVGRFAYEEETQQTLLAATASAY
KFPQTVLAALQEKNEGGVVDLQKLAERTNTVIPAQVATLFDKTIVHTKIIEPAMIMQSIK
DELSI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgtatcaacacgtggacaggcgcctgcagttacatctagccaagcaataata
aacggtattgcgccagatggcggtctttacgttccagaaaaatggccaaaattaaaatta
gattggaaaaatctaagccagcaaagctatcaagaaattgccacgcaagtatttgatgcc
ttttttgatgattttacagttcaggaaattgaccatattatttcaaaatcatatggcaat
caatgggatgctgagagcattgtgaccttgcacaatgaaaacaagttgcactatattgaa
ttgtttcatggaccaaccttagcattcaaagatgttgcactacaggcactaccacatcta
ttaacgacagctgctaaaaagcagtcactaaatgataaaattgttattttaacagctaca
tctggcgatacaggaactgctgctatgagcggctttgcaaatgttgaaaatactgaaata
gttgttttttacccagaagttggtgttagtgatattcagcgtcaacagatgcaaactgaa
gagggacacaatgctcatgttacagcaataactggtaattttgatgatgcccaaaaagct
gtaaaatctattttgagcgatgagaaattaattcaggaattatcagaaaagggtatgcgt
ttttcatcagctaattcaattaatattggtcgattagtaccacaaattgtgtattacatt
tatgcttacgcccaattagtaaaaaatgatgtggtggtaccaggagaagaaatcaatatt
gatgtgccaaccggaaactttggtaatgtgcttgcttcatattatgccagtcagttagga
ttaccagttcatcagtttacagttgcttcggatgaaaataatgtattaactgattttttc
aacactggtatctatgatcgtcaacgtgattttaaagtcacaaattcaccggcaatggat
atcttagtatcaagcaacttggaacggttgttgtattttgctagtggtcgtaatgatgaa
gaagttcgccagtatatgaagtcattagctgaaaatggtcaatataccttgactgataaa
acgcgtaattatttgcaaaaattcacagctaaatttgcgacacaatctcaagtggttgat
acgattaaagatgtctttgaaaatagcggttacttaattgatccgcatacggctgttggt
cgctttgcttacgaagaagaaacacagcaaacgttacttgcagcaacagcaagtgcttat
aagtttccacaaacagttttggcagcattgcaggaaaaaaacgaagggggcgtagtggat
ttgcaaaagctagctgaacgaacaaatacagttattccagcacaagtagcaacgttattt
gataaaactattgtgcacactaaaatcatcgagcctgcgatgattatgcaatctattaaa
gacgaactatctatctga

DBGET integrated database retrieval system