KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0787Help
Entry
LEUM_0787         CDS       T00411                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lme01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lme00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:lme00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
764121..765578
Genome map
AA seq 485 aa AA seqDB search
MNYVSTRGQAPAVTSSQAIINGIAPDGGLYVPEKWPKLKLDWKNLSQQSYQEIATQVFDA
FFDDFTVQEIDHIISKSYGNQWDAESIVTLHNENKLHYIELFHGPTLAFKDVALQALPHL
LTTAAKKQSLNDKIVILTATSGDTGTAAMSGFANVENTEIVVFYPEVGVSDIQRQQMQTE
EGHNAHVTAITGNFDDAQKAVKSILSDEKLIQELSEKGMRFSSANSINIGRLVPQIVYYI
YAYAQLVKNDVVVPGEEINIDVPTGNFGNVLASYYASQLGLPVHQFTVASDENNVLTDFF
NTGIYDRQRDFKVTNSPAMDILVSSNLERLLYFASGRNDEEVRQYMKSLAENGQYTLTDK
TRNYLQKFTAKFATQSQVVDTIKDVFENSGYLIDPHTAVGRFAYEEETQQTLLAATASAY
KFPQTVLAALQEKNEGGVVDLQKLAERTNTVIPAQVATLFDKTIVHTKIIEPAMIMQSIK
DELSI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgtatcaacacgtggacaggcgcctgcagttacatctagccaagcaataata
aacggtattgcgccagatggcggtctttacgttccagaaaaatggccaaaattaaaatta
gattggaaaaatctaagccagcaaagctatcaagaaattgccacgcaagtatttgatgcc
ttttttgatgattttacagttcaggaaattgaccatattatttcaaaatcatatggcaat
caatgggatgctgagagcattgtgaccttgcacaatgaaaacaagttgcactatattgaa
ttgtttcatggaccaaccttagcattcaaagatgttgcactacaggcactaccacatcta
ttaacgacagctgctaaaaagcagtcactaaatgataaaattgttattttaacagctaca
tctggcgatacaggaactgctgctatgagcggctttgcaaatgttgaaaatactgaaata
gttgttttttacccagaagttggtgttagtgatattcagcgtcaacagatgcaaactgaa
gagggacacaatgctcatgttacagcaataactggtaattttgatgatgcccaaaaagct
gtaaaatctattttgagcgatgagaaattaattcaggaattatcagaaaagggtatgcgt
ttttcatcagctaattcaattaatattggtcgattagtaccacaaattgtgtattacatt
tatgcttacgcccaattagtaaaaaatgatgtggtggtaccaggagaagaaatcaatatt
gatgtgccaaccggaaactttggtaatgtgcttgcttcatattatgccagtcagttagga
ttaccagttcatcagtttacagttgcttcggatgaaaataatgtattaactgattttttc
aacactggtatctatgatcgtcaacgtgattttaaagtcacaaattcaccggcaatggat
atcttagtatcaagcaacttggaacggttgttgtattttgctagtggtcgtaatgatgaa
gaagttcgccagtatatgaagtcattagctgaaaatggtcaatataccttgactgataaa
acgcgtaattatttgcaaaaattcacagctaaatttgcgacacaatctcaagtggttgat
acgattaaagatgtctttgaaaatagcggttacttaattgatccgcatacggctgttggt
cgctttgcttacgaagaagaaacacagcaaacgttacttgcagcaacagcaagtgcttat
aagtttccacaaacagttttggcagcattgcaggaaaaaaacgaagggggcgtagtggat
ttgcaaaagctagctgaacgaacaaatacagttattccagcacaagtagcaacgttattt
gataaaactattgtgcacactaaaatcatcgagcctgcgatgattatgcaatctattaaa
gacgaactatctatctga

DBGET integrated database retrieval system