KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0882Help
Entry
LEUM_0882         CDS       T00411                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LEUM_0882
  Lipid metabolism
   00561 Glycerolipid metabolism
    LEUM_0882
   00600 Sphingolipid metabolism
    LEUM_0882
Enzymes [BR:lme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LEUM_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
876526..878748
Genome map
AA seq 740 aa AA seqDB search
MANANISFDDKQNVFHLSNRQISYLIQIEEGGLLSHLYFGKKITKYHGSRHYPRLDRGFS
PNLAGKPHQTDRSYSKDTLLQEYGGYNTGDFRQAAIKIQGANGAQTSDFRFQSFEIVNGK
PHIAHLPQAYVLSEDEAKTLIIYLVDSALNVQVSLYYTIYNDRPVVARSTKITNLSQQSI
NIEKIASLQLDLPASDLEIISLPGAHVRERQMERQTVRQGVAEFSSHRGTSSHHMNPFVA
LVTPNTTENEGEAVGIQLVYSGNHQFTIERDYVEQTRVLSGINEDGFDWQLNADDDFQTP
EALLVYSDEGLNGMSQAYHHLLRERVARGKYQYAERPIVINNWEATYFDFNAEKIQEILD
EASPLGIEMFVLDDGWFGKRDDDDSSLGDWFEYATKLQSGGGLVGLSDKVHEKGMKFGLW
FEPEMISKNSDLYRQHPDYILGMPNRDLTPSRDQYVLDFSRPEVVDNIFQQVVNILDNVK
IDYIKWDMNRHLTEVYSAALSPERQGEVGHRYMLGVYDLADRLTKRYPDILFEGCSGGGG
RFDAGMLYFFPQSWTSDNTDPVERLKIQYGTTLSYPVSSMTAHVSASPNHQTGRQTSLAM
RGDVATAGVFGYELNLAKLSLEEKSEIKDQVTFYKQHRSLIQYGNFYRIKSPFKNNETAW
EFISEDKTEALLFNYRVLSTAQPVFTVTKMSHLKSDGIYVDQRTNEHYSGDELMSIGLYN
TPIKQADFTSAVRYFKWQAE
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgcaaacatttcttttgatgacaagcaaaatgtttttcatctttcaaatcga
caaatatcttacctgatacaaattgaagagggcggactgctaagccatctctattttggt
aaaaaaattacaaaatatcatggttcacgacattatccacgtctagatagaggattctca
ccaaacttagctggaaaaccacatcaaacagatcgtagctattcgaaggacacattatta
caagaatacggtggttataatacgggagattttcgtcaagccgcgattaaaattcaagga
gccaacggtgcacaaacatctgattttcgttttcaatcattcgaaatcgtaaatggtaag
ccacatatagctcatctgcctcaggcctacgtgttatcagaagatgaagctaaaacatta
ataatttatcttgtggatagtgcgctaaatgtccaagtatcgctttattacacaatttat
aatgaccggccagtagttgcaagatcaactaaaataacgaatctctctcaacaaagtatt
aatattgagaaaattgcatcactgcaattagatttaccagcaagtgatctagaaatcatc
tcgttacccggcgcccatgtgcgtgaacgtcaaatggagcgacaaactgtgcgccaagga
gtggctgaattttctagtcatcgaggaacaagctcgcaccacatgaatccatttgtagcg
ctagtaacaccgaacacaaccgaaaatgagggtgaagctgttggtatccaactggtttat
tcgggaaatcatcaattcactatcgaaagagattatgtggaacagacacgtgttctatct
ggtattaacgaagatggatttgattggcaattaaacgctgatgatgactttcagacacct
gaagcgttgttggtttattctgatgaaggtttaaatggtatgtcacaagcttaccatcac
ttgctacgagaacgtgtggctcgtggaaaatatcaatatgcagagagaccaattgttatt
aataactgggaagcaacttattttgattttaatgcagaaaaaattcaagagatattagat
gaagcatccccattaggcattgaaatgtttgtcttagatgatggttggtttggaaaacgt
gatgatgatgatagctctttgggtgactggtttgaatacgccactaaattacagagtggc
ggtggtttagttggcttgtcagataaagtacacgaaaaaggtatgaaatttggattatgg
tttgaaccggaaatgatttccaaaaattctgatctctatcgacaacatcctgattatatt
ctcggtatgcctaaccgtgatttgacccctagtcgtgatcaatatgtgcttgatttttca
agacctgaggtagtggataatattttccaacaagtagtaaatatcttggataatgttaag
attgattacattaagtgggacatgaaccgtcatttaacagaagtatattctgcagcgttg
tcaccagaacgtcaaggagaagtgggacatcgttatatgttaggtgtgtatgatttggcg
gatcgtttgaccaaacgttatccagatattttatttgaaggatgctctggcggtggcgga
cgatttgacgctggcatgttatatttctttccacaatcgtggacatcagacaatacggac
cctgttgagcgcttaaaaattcaatatgggacgacattaagctacccagtctctagtatg
accgcgcatgtttcagcatcgcctaatcatcaaactgggcgtcaaacgagtctggctatg
cgtggggatgttgctactgcaggagtctttggatatgaattaaacctagctaagttgtca
ttagaagaaaaatcagaaatcaaagatcaagtgacattttataaacagcatcgctcgttg
atccagtatggcaatttttaccgtatcaaaagtccttttaaaaataatgaaacagcctgg
gaatttatcagtgaagataagacagaagcattgttattcaattaccgtgttttgtcaact
gcgcagccagttttcactgtaactaaaatgagtcacctgaaatctgacggaatctatgtt
gatcaaagaacaaatgaacattattctggagatgaactcatgtcaattggtctatataac
acgccaattaagcaagctgattttacctctgcggtgcgttatttcaaatggcaagctgaa
taa

DBGET integrated database retrieval system