KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0927Help
Entry
LEUM_0927         CDS       T00411                                 

Definition
beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_0927
Enzymes [BR:lme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LEUM_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929498..930934
Genome map
AA seq 478 aa AA seqDB search
MSKRLSEDFLWGGAVAAHQLEGAWQEGGKGVSVADIMTVGGPDKERNITKGVVSGEYYPN
HEAIDFYHRYKADIALFKEMGFKCFRTSIAWTRIYPTGEESEPNEAGLKFYDDLFDELIK
NNIEPVITLSHFELPYHLVTKYGGFRNRKVIDLFVKFATTCLKRYKDKVKYWMTFNEINN
QANYDNDFLVFTNSGLHFNPGENREEGMYQAAHNELVASARVVKMGHDINPNFQIGCMIA
MGPIYPASMNPDDVLAAQKSMEKNYFFADVHVNGQYPAFLTKYWTRKGFNIDVTQEDLAD
LQAGTVDYIGFSYYMSHAVKKPEGLNFDDMTPENSQVRNTYLAASDWGWQIDPKGLRYAL
NWFTDKYHLPLFIVENGFGAYDKVEEDGTIHDSYRIAYLQEHIREMKLAVVEDGVDLIGY
TPWGCIDLVSAGTGEMDKRYGFIHVDKNNQNEGSLKRSKKDSFYWFKDVIATNAENIN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacgtttatctgaagattttctttggggtggtgctgttgcagctcaccaatta
gaaggtgcgtggcaagaaggaggtaaaggagttagtgtcgctgacatcatgacggttggt
ggaccagacaaagagcgaaacattacgaaaggagttgtttcaggagaatattatcctaat
catgaagcgattgatttttatcaccgttacaaagcagacattgccttatttaaagaaatg
ggatttaaatgttttcgaacttcaattgcatggacaagaatttatcctactggtgaggaa
agcgagccaaatgaggcaggtttaaaattttatgatgacttatttgatgaacttatcaaa
aataatattgaaccagtcatcacgttatctcatttcgaattaccgtaccacttggttaca
aaatatggtggtttccgtaatcgaaaagtaatcgatttattcgttaagtttgcaacgact
tgtttaaagcgatacaaagacaaggtcaaatattggatgacgtttaacgagattaacaat
caggctaactatgataatgattttctggttttcacaaattctgggctgcattttaaccct
ggtgaaaatcgtgaggagggtatgtatcaagctgctcataatgaattagtagctagcgca
cgagttgttaaaatgggtcatgacatcaatcccaattttcaaattggctgtatgattgct
atgggaccaatttatccagcatctatgaatccagatgatgttctggcagctcaaaagagc
atggaaaaaaattatttctttgcagacgtgcatgtcaatggtcaatatccagcattttta
acaaaatattggactcggaagggatttaacattgatgttacccaagaagacctggcagac
ttacaagctggtaccgttgattatattggttttagttactacatgtcacatgcagttaaa
aagccagaaggtttaaactttgatgacatgacaccagaaaatagccaagtacgtaatacc
tatttagcagcaagtgattggggatggcaaattgatcctaaggggctgcgttacgccctg
aactggtttacagataaatatcatttaccattatttattgttgagaatggatttggcgca
tacgataaagttgaagaagatggtacaatacatgattcttatcgcattgcatatttacaa
gaacacattcgggaaatgaagttggcggtagttgaagacggcgttgatttgattggatat
acaccgtggggatgtattgacttggtttcagccgggactggagaaatggacaaacgatac
ggatttatccatgtagacaaaaataaccaaaatgagggttcattgaaacgtagcaaaaag
gattccttttattggtttaaagacgttatcgcaacgaacgctgaaaatattaattaa

DBGET integrated database retrieval system