KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1172Help
Entry
LEUM_1172         CDS       T00411                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LEUM_1172
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEUM_1172
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LEUM_1172
Enzymes [BR:lme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LEUM_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1169458..1170234)
Genome map
AA seq 258 aa AA seqDB search
MTRISQALENKNAFIGFAVAGYPDFEKSAKYIVDMAEAGADLIEIGIAFSDPSADGPTIM
NADQEVLENGSTTADVFNLVAEVRKHTDVPLVFLTYTNPVFKYGYEKFLSKMQSLDIQGV
IMPDMPMEEQDEFLELVHQYGRDFIQLVTLQSGNRLPKIVERASGFIYVVSSLGITGSRS
KLSNEADEIVTKIKRLTDLPVAVGFGITTYDQAKQFESADAIIVGSALVKIIEDHPEDAT
SYLTDFIKNMKGARHATN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactagaatttcacaggcattagaaaataaaaatgcttttattggtttcgcggtagct
ggatatccggattttgaaaagagtgcaaaatatattgttgatatggctgaggctggtgca
gatcttattgagattggcattgcttttagtgatccaagtgctgacggtcccactatcatg
aatgctgatcaagaggttctcgaaaacggttcaacaacagctgatgtatttaatttagtt
gctgaagttcgcaaacacacggatgtgcctttagtttttctaacgtatacaaatccagta
tttaaatatgggtacgaaaaatttctcagcaaaatgcagtcgttggatattcagggtgtt
attatgcccgacatgcctatggaagaacaagatgaatttttggaacttgtccaccagtat
ggtcgcgactttattcaactcgtaacattacaatccggaaatcgtttgccgaaaattgta
gaacgtgcttctggatttatatatgtagtaagttccttaggaataacaggctctagaagt
aaattgtcaaacgaagctgatgaaatcgttactaagattaagcggttaacagatttgcca
gttgcagttggttttggcatcacgacatatgatcaagcaaaacaatttgaatctgctgat
gcgattattgttggctcagcacttgtcaaaattatcgaagaccacccagaggatgctaca
tcttatttgacagattttattaaaaacatgaaaggagcgcgtcatgcgacaaattaa

DBGET integrated database retrieval system