KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1172Help
Entry
LEUM_1172         CDS       T00411                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00260  Glycine, serine and threonine metabolism
lme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lme01100  Metabolic pathways
lme01110  Biosynthesis of secondary metabolites
lme01130  Biosynthesis of antibiotics
lme01230  Biosynthesis of amino acids
Module
lme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEUM_1172
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LEUM_1172
Enzymes [BR:lme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LEUM_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ABJ62270
JGI: LEUM1172
UniProt: Q03X02
Position
complement(1169458..1170234)
Genome map
AA seq 258 aa AA seqDB search
MTRISQALENKNAFIGFAVAGYPDFEKSAKYIVDMAEAGADLIEIGIAFSDPSADGPTIM
NADQEVLENGSTTADVFNLVAEVRKHTDVPLVFLTYTNPVFKYGYEKFLSKMQSLDIQGV
IMPDMPMEEQDEFLELVHQYGRDFIQLVTLQSGNRLPKIVERASGFIYVVSSLGITGSRS
KLSNEADEIVTKIKRLTDLPVAVGFGITTYDQAKQFESADAIIVGSALVKIIEDHPEDAT
SYLTDFIKNMKGARHATN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactagaatttcacaggcattagaaaataaaaatgcttttattggtttcgcggtagct
ggatatccggattttgaaaagagtgcaaaatatattgttgatatggctgaggctggtgca
gatcttattgagattggcattgcttttagtgatccaagtgctgacggtcccactatcatg
aatgctgatcaagaggttctcgaaaacggttcaacaacagctgatgtatttaatttagtt
gctgaagttcgcaaacacacggatgtgcctttagtttttctaacgtatacaaatccagta
tttaaatatgggtacgaaaaatttctcagcaaaatgcagtcgttggatattcagggtgtt
attatgcccgacatgcctatggaagaacaagatgaatttttggaacttgtccaccagtat
ggtcgcgactttattcaactcgtaacattacaatccggaaatcgtttgccgaaaattgta
gaacgtgcttctggatttatatatgtagtaagttccttaggaataacaggctctagaagt
aaattgtcaaacgaagctgatgaaatcgttactaagattaagcggttaacagatttgcca
gttgcagttggttttggcatcacgacatatgatcaagcaaaacaatttgaatctgctgat
gcgattattgttggctcagcacttgtcaaaattatcgaagaccacccagaggatgctaca
tcttatttgacagattttattaaaaacatgaaaggagcgcgtcatgcgacaaattaa

DBGET integrated database retrieval system