KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1174Help
Entry
LEUM_1174         CDS       T00411                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LEUM_1174
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LEUM_1174
Enzymes [BR:lme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LEUM_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1170803..1171591)
Genome map
AA seq 262 aa AA seqDB search
MILDDLVAATCQNMLARQAQKSLHDLQKEAAHITVSREFPFEKSLAQQKISVVAEIKQAS
PSKGQIVPSSEFDYQGIAKDYEVAGVDAISVLTEENYFKGSLDILKTVAADSATPVLRKD
FTIDPYMIYEAKVAGSQIILLIVAILTDEQLKEYLSLANELGLSVIVEAHNEEEILRAVK
ANARIIGVNNRNLKDFTVDFDNTKRLRQLVPPEILFISESGIKDRSDVVTLEQIGVDGIL
VGETFMKAADKLAAIQQLRGEK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgatttagtagcagcaacatgtcaaaatatgttggcgcgtcaagctcaa
aaatcgctgcatgacttacaaaaagaagcagcacacatcacagtttcaagagaatttcct
ttcgaaaaaagtctagctcaacagaaaatatcagttgttgccgaaattaaacaagcatcc
ccatcgaaagggcaaattgtaccttcatcagagtttgattatcaagggatcgcgaaagac
tatgaggtggcaggtgtcgatgcgataagcgttttgacagaagagaattatttcaaggga
tctcttgatattttaaaaacagttgcagcagattctgctactcctgtattacgcaaagat
tttacaattgatccatacatgatttatgaggctaaagtagctggatcacaaatcatttta
ttaatcgttgctattttaacggacgaacaattaaaagaatacctatctttagcaaacgaa
ttaggattgtcagtgattgtggaagcgcacaatgaagaagagattctccgagcagtgaag
gcaaatgcacgaattattggtgtgaacaatcgtaatttaaaagacttcacggtcgacttt
gacaacactaaacgtttacgacaattagttccaccagaaattttatttatttcagaatct
ggtataaaagatcgctcagatgttgttacccttgaacagattggcgtggacggtatttta
gttggtgagacgttcatgaaggctgcagataaattagcggccatacaacagttaaggggc
gaaaaatga

DBGET integrated database retrieval system