KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1176Help
Entry
LEUM_1176         CDS       T00411                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LEUM_1176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEUM_1176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LEUM_1176
Enzymes [BR:lme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LEUM_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1172606..1173793)
Genome map
AA seq 395 aa AA seqDB search
MTRKGYYGEYGGQFVPELLMPAINEVTEAFNKYKEDPAFKSELKDLFDNYANRPSMLYYA
KNMSEDLGGAQIYLKREDLNHTGAHKINNVLGQALIAKKMGKTRLIAETGAGQHGVATAT
AAALFGMEAEIFMGKEDTERQALNVYRMELLGAKVHAVTTGTQVLKDAVNATFQDWTKRI
DDTFYVLGSAVGPYPFPEMVKYFQSVISEEARRQFLEMTGKLPDAVIAAVGGGSNAIGAF
AKFIDDAEVELIGVEAAGKGVKTDQTAATMALGSKGVFHGMKSQFLQSADGQIDPVYSIS
AGLDYPGIGPEHVYLKDIHRATYVPITDDEAVDAFEYIAKTEGVIAAIESAHAVAYAMKL
APKMRKDQQIMVNLSGRGDKDVAAIARYKGVDIHE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaaaggttattacggagaatatgggggacaatttgttccagaattgctaatg
ccagcaattaatgaagtcacagaggcattcaataaatataaagaggatccagcttttaaa
agtgaattgaaagatttattcgacaattacgcgaaccgaccatctatgttatattatgca
aaaaatatgtctgaagacttaggtggtgcgcaaatttatctaaagagagaagatttaaat
cacactggtgctcataaaattaacaatgttttagggcaagcattaattgccaaaaaaatg
ggtaaaacacgtttaattgctgaaacaggtgccggacaacatggcgtggcaacagctacg
gctgcggcattgtttggtatggaagcagaaatttttatgggcaaggaggatacagaacga
caggcgttgaatgtttatcgcatggagctactaggggccaaagttcatgcggtgacaaca
ggaacacaagtcttaaaagatgcagtgaacgcaacatttcaagactggacaaaaagaatt
gatgatactttctatgtacttggttcagcggttggtccatatcccttcccagaaatggtt
aaatatttccaatcggttataagtgaggaagccagaaggcaattcttagaaatgactgga
aaactgccagacgctgtaattgctgccgttggtggtggatcgaatgcaattggtgctttc
gctaagttcattgatgacgcagaagtggaattgattggcgttgaagccgctggaaaaggc
gtaaaaactgatcaaacagctgcaaccatggcactaggttcaaaaggtgtttttcatggt
atgaaatcccaatttttacaatcagccgatgggcaaattgatcctgtttacagtatttct
gcaggattggactatcctggcatcggaccggagcatgtttatctaaaggatattcaccga
gcaacttatgtaccgattacagatgatgaagcagttgatgcatttgaatacattgcaaaa
acagagggtgtaattgctgcaattgaaagcgcacacgcagtagcctatgcaatgaaatta
gcaccaaaaatgagaaaagatcaacaaataatggttaatctgagtggtcgaggtgacaaa
gacgttgctgcgatagcccgttataaaggagttgatattcatgagtaa

DBGET integrated database retrieval system