KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1456Help
Entry
LEUM_1456         CDS       T00411                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LEUM_1456
Enzymes [BR:lme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LEUM_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1449343..1451709
Genome map
AA seq 788 aa AA seqDB search
MNIDSTDYLNNLDAYWRATNYLSVGQLYLLDNPLLKEKLTAEQVKIHPIGHWGTIPSQNF
IYAHLNRAINKFNLNMFYIEGPGHGGQVMISNAYLDGSYTEAFPEITQDEAGMQKMFKRF
SFPGGVASHADPKVPGSIHEGGALGYSILHGAGAVLDNPDLIAAVVVGDGEAETAPLATS
WHVNKFLNPKNDGTVLPILNLNGFKIANPTVLSRESDETLTDYFHSLGWHPYFVSSFDKP
IMQVHEEMAKTMDTVFTEIKDIREKAVQQTNEEITRPLWPMIVLRSPKGWTGPKTWDDKP
IENSFRAHQIPIPADQNHPEYIPQLVDWLQSYKPDELFDENGQLTQSIQEVLPKKELRMA
NNSVTNAGIIKPLILPDIDNYLVENNQPDNNLAQDAILLGDYLRDIIKLNPTNFRGFGPD
ETASNRFQDIFETTNRQWLLPIKEPNDQFMAPEGRIIDSMLSEHYDEGMLEAYTLTGRHG
FFASYEVFIREVDDMIVQHFKWLNHSHDVSWRKDVPALNIIADSTVFQQDHNGYSHQDPG
VTTMLYEKQPDFIREFFPADANSLVATFEHAAQATQQINYIVASKHPRLQWFSPTEAKQL
VTQGLRVIDWASTDKGEKPDIIITSAGSEPTTESLAAIQILHEHIPSLKIRYINVLDLFK
LRADASYGLSDDEFDAYFTTDTPVLFAFHGYEPMIESIFFKRHNHHLAVHGYREVGDITT
PFDMRVLNKIDRFNLVKAAINLLPENIRTKQAALVQEMTDKLDLHVAYTRSKGTDLPEVE
DWRWRPLK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgattcaacagattacctgaacaatttagatgcctactggcgagctaccaat
tatttgtcagttggacaactctatttgttagataacccattgcttaaggaaaagttaacg
gcagaacaagttaaaattcacccaatcgggcactggggcacgattcctagtcaaaacttt
atttatgcccatttaaatcgtgctattaataaatttaatttgaatatgttttacattgag
gggcctggccatggcggacaagtaatgatttcaaatgcttatcttgatggtagttatacc
gaagcatttccagaaatcacacaggatgaagcgggtatgcagaaaatgtttaagcgtttc
tctttccccggtggcgttgcttcacatgctgatcctaaagtacctggatcgattcatgaa
ggtggtgctttaggctattctatcttgcacggtgctggtgctgtattggataatccagac
ctcattgctgcggttgttgttggcgatggtgaagcagaaacagcacccctagccacttca
tggcatgttaataaatttttgaatcctaaaaatgatggtactgtattaccaattttgaat
ttaaatggcttcaagattgcgaatcccacagttctctctcgagaatctgatgaaacacta
accgattatttccacagtctgggatggcacccttactttgtaagttcttttgacaaaccg
attatgcaagttcatgaagaaatggcaaaaaccatggacacagtatttactgagattaaa
gacattagagaaaaagccgttcagcagacaaatgaagagattacacgaccactttggcca
atgattgttttacgttcacctaaaggctggacagggccaaaaacttgggatgacaaacca
attgaaaattcatttcgtgcacaccaaattccaattcctgctgaccaaaatcatcctgaa
tatataccacaacttgttgattggttacaatcttacaaaccagatgaattatttgatgaa
aacggtcagttaacacaatctatccaagaagtattaccgaaaaaagagctacgtatggcc
aataattcggtcaccaatgctggtattatcaaacctttgattttacctgacattgacaat
tacttggtagaaaataatcagccagacaataacttagctcaagatgctattttgttaggt
gactatttgcgtgatatcatcaaacttaatcctactaacttccgtggctttggcccagat
gaaacagcttctaatcgtttccaagacatttttgaaacaactaatcgccaatggctatta
ccaatcaaagaacctaatgatcaattcatggcacctgaaggccgtattattgattctatg
ttatcagagcattatgatgaggggatgcttgaagcttatacgctaaccggtcgtcatgga
ttctttgccagttatgaggtctttattcgtgaagttgatgacatgattgtgcaacatttt
aagtggttgaatcattctcatgacgtttcatggcgtaaggacgtaccggcattaaatatt
attgctgattcaaccgttttccaacaagaccataatggttactcacaccaagatcctggt
gtaacaacaatgttgtatgaaaagcaaccagacttcattcgcgagttcttcccagcggat
gctaatagcttggtcgcaacatttgaacatgctgcgcaagcaacgcaacagattaattat
attgtggccagcaaacatccccgcttacagtggttctcacctactgaggccaaacagctt
gttacgcagggattacgtgtcattgattgggcaagtactgacaaaggtgaaaaacctgat
attattattacttcagctggttctgaaccaacgacagaaagtttagcagcaatacaaatt
ttgcacgaacacataccatcattaaaaatacgttacatcaatgtattggatctatttaaa
ctacgggccgatgccagctatggcttaagtgatgatgaatttgatgcttacttcactact
gacacaccagtattatttgcattccatggctatgaaccaatgattgaatctattttcttc
aaacgacacaatcaccacttagcagttcatggttaccgagaagttggtgacattacaaca
ccatttgatatgcgtgttcttaacaaaattgatcgatttaatttagttaaagctgctatt
aatctcttgccagaaaatattcgcaccaagcaagcagccctcgtgcaagaaatgaccgat
aagctcgacctacacgttgcgtatactaggtcaaagggaacggacttgcccgaagtagaa
gattggcgctggcgaccacttaagtga

DBGET integrated database retrieval system