KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1596Help
Entry
LEUM_1596         CDS       T00411                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEUM_1596
   01230 Biosynthesis of amino acids
    LEUM_1596
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_1596
  Energy metabolism
   00680 Methane metabolism
    LEUM_1596
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEUM_1596
Enzymes [BR:lme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LEUM_1596
Exosome [BR:lme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LEUM_1596
  Exosomal proteins of melanoma cells
   LEUM_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1599199..1599861)
Genome map
AA seq 220 aa AA seqDB search
MAAKLVLVRHGESTANRDNEFTGWTDVPLTLKGVRQANRVGEVLKRHGLQFDVSFTSFLK
RAIITDNIILEEIEQLWLPLHKAWQLNERHYGALRGLNKDYARQQYGANKVALWRRSYTA
TPPLLEHVIPDRRYPEDLEPRGESLKMASDRLVPYWHSEILPQIQQDKNVLIVAHGSSLR
ALVKYIEHISDEDIDGLEIDNGEPILYEYEEGFSERIYLE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaaacttgtgttagttcgccacggagagtcaacagcaaaccgtgacaatgaa
tttaccggatggactgacgttccactgaccttaaaaggggttagacaagcgaaccgtgtt
ggtgaagttttgaagcgacatggtttgcaattcgatgtatcatttacttcttttttaaag
cgcgcaatcataactgacaatattatattggaagaaattgagcagttgtggttaccactc
cataaggcttggcaactcaatgagcggcactatggtgcattacgtggcttgaataaagat
tacgctcgtcaacaatatggcgcaaataaagttgccttatggcgacgtagttatacggct
acgccaccactactagaacacgttattccagatagacgttacccggaagacttagaacca
cgtggtgagagcttgaaaatggccagtgatcggcttgttccttattggcattcagaaatc
ttacctcagatacagcaggataaaaatgtcttaatcgtcgcacatggtagctccttacgt
gctttagtcaaatatatagaacatattagcgatgaagacatagacggtcttgagattgac
aatggcgaacctattttgtacgagtatgaagaaggatttagtgagaggatttatttagaa
tga

DBGET integrated database retrieval system